KEGG   Coccidioides posadasii: CPC735_065510Help
Entry
CPC735_065510     CDS       T01332                                 

Definition
cAMP-dependent protein kinase type 2, putative
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cpw  Coccidioides posadasii
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CPC735_065510
Enzymes [BR:cpw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CPC735_065510
Protein kinases [BR:cpw01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CPC735_065510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 482 aa AA seqDB search
MPIFGGLLKKRRTKDPKASKDLQSTASSSAESPSSVPSASSQRSSPQLGQHSTVNTSASA
APPERPIDAGTSDATQLNISSATPDVRAGATGDSTVMNSQQIQNHSPVPGGSPQPVSPQH
HQNVASIKNIINPPQQEEVLSQGANDGRFPSQQPVRTTQRQLKGKYSLNDFTLRRTLGTG
SFGRVHLVQSVHNQRFYAIKVLKKQQVVKMKQVEHTNDERRMLERVKHPFLITLWGTFQD
AKNLYMVMDFVEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSQNIVYRDLKPENL
LLDRHGHLKITDFGFAKEVRDITWTLCGTPDYLAPEVVSSKGYNKSVDWWSLGILIFEML
CGFTPFWDSGSPMKIYENIVHGRVKYPPFLVPDARDLLSQLITPDLTKRLGNLRGGSEDV
KNHAWFSEVTWDRLARKDIDAPYIPPVKAGQGDASQFDTYPEETEQYGLPADDEFGHFFQ
EF
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgccgattttcggaggcctcctcaagaagcggcggacgaaggacccaaaagcgtcaaaa
gacctacaatcgacagcctcgtctagtgctgaatcaccttcatcggttccatcggcaagt
tcacagcgtagttcgccacagctcggccagcattcgactgtcaatacgtccgcttccgct
gcccctcctgagcgaccaattgacgccggaacgtccgacgctacacaactgaacatctct
tccgcaaccccagacgtccgtgcgggtgctacgggtgatagcaccgtcatgaactcgcaa
caaatccaaaatcattctcctgtgcccgggggatctccgcaaccagtatccccgcagcac
catcaaaatgtcgcaagtatcaaaaacatcataaatccacctcaacaggaagaagtactc
tcccaaggagccaatgacggtcgcttcccttcccagcagccagttcggacgacccagaga
caattgaagggaaaatattcccttaacgacttcacactccgccgcaccttgggaacaggc
agttttggaagagtacacctggtgcaatcggtacataaccaacgtttctatgcgataaag
gtattgaaaaaacaacaagtagtgaagatgaagcaggtggagcataccaatgatgagcgg
agaatgttggaaagggtgaagcatcctttcctaatcactctctggggaaccttccaggat
gccaagaatctgtacatggtgatggactttgtggagggtggagagctattcagtttgctc
cgcaagtcgcagcgattcccgaacccagtcgcaaagttttatgcagccgaagtcacactt
gcattagaatacctacattcacaaaacatcgtttatagagatctcaaacccgagaatctt
ctccttgatagacatggtcatctcaaaatcactgatttcggcttcgccaaagaagttcgg
gatataacatggaccctttgtggaacgcccgactatcttgctccagaagtggtttcctcg
aagggatacaataaatcagttgactggtggtcccttggaatccttatcttcgaaatgctt
tgcggctttacaccgttttgggatagtggatctcccatgaaaatatatgagaatatcgtc
catggccgggttaagtaccctccattcttagtccctgatgctcgggatctcttgtcgcaa
ctcatcacccccgatctcacgaagcggctaggtaaccttcggggcggatcggaagatgtc
aaaaaccacgcatggttctcggaagttacttgggacagacttgccaggaaagatatcgat
gctccgtatatacctccagttaaagctgggcaaggagacgctagccagttcgacacctac
cccgaagaaacggagcaatacggcctaccagctgatgatgagtttggccatttcttccaa
gaattttaa

DBGET integrated database retrieval system