KEGG   Coccidioides posadasii: CPC735_065680Help
Entry
CPC735_065680     CDS       T01332                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
cpw  Coccidioides posadasii
Brite
Enzymes [BR:cpw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CPC735_065680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 528 aa AA seqDB search
MEDQSAWTCSSNDAVQVSIVQPKGDGKLSTLSTFYPEFTYSIFGDSETIFGYTGLMIQLR
FAAHDLRSNVCISYDEKFKTVKDVSAVDLNKILKPFLPEESFIPLKKFEESLTKDKSAKD
FKPPGEIVHTYTKGDRNYEVWAGCLADPDVQELLERIQIFASLFIEGGTPIEINDPEWTL
ERWMVYFVYEKLPEPPTPDASIYSFVGYGTTYKWYFYSPTSEKCKVSNGPFPYETVINLA
ELPSRLRISQFLILKPHQLSGHGTQLYQTIHRASLKDPTVYELTVEDPNEAFDSLRDTND
YHLLQPVFKHHNVTINANPYPATQPGRAQHRLVPTSRLIPVETLRGIRTKYKIAPTQFAH
LVEMYLLSLIPMSHRGSHNVNLPRLRILKSRAPDEHDRQYYWWRMLVKQRLFKRHRDMLI
QIDQAERVQKLEETLHNVEEGYENLLKAFGMKATREPAESATPVTDEQQIQEEESGARAE
HAVVRERTKRRFVVMEDEDEDDGDDQGVSSEGGGEKDNTNPPSKKARV
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggaggaccaatctgcatggacctgcagctccaatgacgccgttcaagtctccatcgtc
cagccaaagggcgatggcaagcttagcacgctctcaacattctaccctgagtttacttat
tccatttttggcgacagcgaaacgatatttggatatacgggattgatgattcagcttcgc
tttgcagcgcatgatttgagatcgaacgtttgcatctcatacgacgagaaattcaaaacg
gtcaaggacgtctctgcggtggatttaaacaaaatattaaagccatttttaccagaagaa
tcgttcattcccctcaaaaagttcgaggaatccctgacgaaggataagtctgcaaaagat
tttaaaccccccggagaaattgttcatacatacactaagggcgatcgcaattatgaagta
tgggctggttgtctagccgatccggatgtccaggagctcttggagcgtattcagatattt
gcgtctctcttcatcgagggtggaaccccaattgaaataaatgaccctgaatggacctta
gaaagatggatggtatactttgtatatgagaaattgcccgagcctcctaccccagatgct
tctatctactccttcgtgggatacggtacaacatacaagtggtacttttactccccaacg
agcgaaaagtgcaaagtttcgaacggcccctttccgtacgaaaccgtgattaacctggcg
gaactaccgtcgcgcctccgcatctctcaattcctcatccttaaacctcatcaattatct
ggtcatggcactcagctttatcaaactatccatcgtgcctccctcaaagaccctactgtc
tacgagcttactgttgaagatccaaacgaggcctttgactctctccgcgacacaaacgat
tatcatctccttcaacccgttttcaaacaccacaatgtcacaattaacgcaaacccgtat
cccgccactcaaccaggccgtgctcagcaccgcctcgttcctacatcccgtcttatcccc
gttgagactctccgcggcatccgtacaaaatacaaaatcgcaccgactcaatttgcccac
ctggtagaaatgtacctgctcagccttatccccatgtcgcatcgtggctctcacaatgtc
aacctaccccgactacgtattctcaagtcccgtgctccagacgagcatgataggcaatac
tactggtggcggatgcttgttaagcagcgactgttcaaacgccatcgagacatgctgatt
cagattgaccaggctgaacgagtgcagaagctcgaagaaaccctacataatgttgaagaa
ggctatgagaacttactcaaagcctttggcatgaaggcaacaagggagccggctgaaagc
gcaacgcctgtaacggacgagcaacagatccaggaagaagagagtggagctcgcgcagaa
catgcggttgtcagagagcggacaaagagaagatttgttgtcatggaggacgaggatgaa
gatgatggtgatgatcaaggtgtcagtagcgaaggaggtggcgagaaagacaatacaaat
ccaccctccaaaaaggccagagtgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system