KEGG   Coccidioides posadasii: CPC735_066070Help
Entry
CPC735_066070     CDS       T01332                                 

Definition
dihydrolipoamide acetyltransferase, putative (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cpw  Coccidioides posadasii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPC735_066070
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPC735_066070
   00020 Citrate cycle (TCA cycle)
    CPC735_066070
   00620 Pyruvate metabolism
    CPC735_066070
Enzymes [BR:cpw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CPC735_066070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 495 aa AA seqDB search
MASAAVMSRFPSCRLLVSRPASTLRESRNVYRLRDAARPQLPLYASLARYYASKSYPPHT
IISMPALSPTMTAGNIGAWQKKVGDTLSPGDVLVEIETDKAQMDFEFQEEGVLAKILKEA
GEKDVSVGNPIAVMVEEGTDIAQFESFSLEDAGGDKKPSTDKTPKETPESSKGPEAEAEG
QSLAQDEAKPAAEEPDITGERLQPSIDREPLISPAAKALALERGVPIKTLKGTGPGGRIT
KEDVEKYQPTTPVGAAAGPTYEDIPASSMRKVIASRLTQSMKDNPHYFVSSTLSVTKLLK
LRQALNSSADGKYKLSVNDFLIKACALALRKVPAVNSAWIEQNGQVVIRQHNTVDISVAV
ATPVGLITPIVKGVEGLGLESISRQVKDLGKRARDNKLKPEEFNGGTFTISNMGMNPAVE
RFTAVINPPQAAILAVGTTRKVAVPLETEEGTEVQWDDQIVVTGSFDHKVVDGAVGAEFM
RELKKVVENPLELML
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgctgcggtgatgtcgcgattcccttcttgtcgtctgcttgtctccagaccc
gcttccaccctacgagagtcgcggaatgtgtacagactgcgcgatgccgcacggccacaa
ttgcctctctacgcttcccttgcgagatactatgcctcgaaatcttatcctccccatact
atcatcagcatgccagcattgtcgcccacaatgaccgcaggtaacatcggcgcatggcag
aaaaaggtcggcgacacactgtcaccaggcgacgtcctggtcgaaattgaaacagacaag
gcacaaatggacttcgagttccaagaagaaggtgttcttgcgaaaattttgaaggaagct
ggagaaaaggatgtttctgttgggaatcccattgccgtcatggttgaagaaggcaccgat
atcgcccagttcgaatcattttccctggaagatgctggcggcgataagaagccatctact
gataagactccaaaagagactcccgagtcctcaaagggacctgaagccgaagccgaaggc
caatcgctcgcacaggacgaggctaagcccgccgcagaagaaccagatatcactggggaa
cgccttcaaccatccattgatagagaacccttgatcagcccggctgccaaggcccttgct
ttagaacgtggagtgccaataaagaccctcaagggaacaggccctggaggtcgaatcacc
aaggaagatgttgaaaaataccagcccaccacgcccgtcggtgctgctgcaggcccaacc
tacgaagatattcctgcctcatcaatgcgtaaggtcattgctagccgcctcactcaatcc
atgaaggataacccccattacttcgtctcctcaactttgtccgtcacaaaactcctcaaa
cttcgccaagctctaaactccagtgcagacggcaaatacaagctctccgttaatgacttc
ctcatcaaagcatgtgctctcgcacttcgcaaagtccccgctgtcaattcagcttggatt
gagcagaatggacaggttgtgattcgccagcataatacggttgatattagcgttgcggtc
gcgactcctgttgggctcattactcccatcgtgaaaggcgtggagggacttggcctggaa
agcatttcgcgtcaagttaaggatctcggcaagcgtgcccgagacaataagctaaaacct
gaggagttcaatggtggcaccttcaccatcagcaacatgggtatgaatcctgcggttgaa
agatttactgctgtgatcaaccctcctcaagctgctatacttgctgtcgggactacacga
aaggtagccgtgcctttggagacggaagagggtactgaggtgcagtgggacgaccagatt
gtggtcactggaagctttgaccacaaggtggtcgatggggcagttggggccgagttcatg
cgagagttgaagaaagtggtcgagaaccctcttgaacttatgctatga

DBGET integrated database retrieval system