KEGG   Coccidioides posadasii: CPC735_066250Help
Entry
CPC735_066250     CDS       T01332                                 

Definition
Ubiquitin carboxyl-terminal hydrolase family protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
cpw  Coccidioides posadasii
Brite
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CPC735_066250
Peptidases [BR:cpw01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CPC735_066250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1527 aa AA seqDB search
MSSTGGANGKSTSCDQPMQDAQNGHPDYRSSSPTLKRPAAEMGGDEQKENGDSMDTDPPS
SKSIIEIQVDNSHLKKKNDRPDRHARAASVDMIGRDNDTGPKTSSEEATSSGSDSVYPTP
SSMSTYTHSTYEERSQAISSHSNHSSHAVPSLDEQVATVMQMVMQPPQEKQRGYVVSGTW
LNRVLARSSKGPMRDKSDKTAAEGEIGPVDNSDLVLVTDPSTLFKDEAGEPFVPLRPGLQ
MGEDFEIFPQEAWDLIISWYGLSKNSPAIVRYAHNTNTPGNTENIQYELNPPVFTILKLP
SPTNPAVQLSTDKSRTPVKTLASSHTPFQQWLRNAKKLASIQPTTKVRVWRILEGLGTSG
TVTPAASRSASPAPGSTLIANAGDSLVLDTNKFVALSEGSQRELVELKDQTSNEKYNGSV
TLHLAGLSGDNVIVLEEQIGGAGGGEWASDAAKYGSSRLAALTTTTTTTKVAPQSKFKSP
AVPTSGRASPVPSVVTRGRKRKDGKTRGVTGLSNLGNTCYMNSALQCVRSVEELTQYFLA
NEYKKDLNPSNPLSHNGDVARTYANLLHQMFDENAPDSISPRSFKLTIGRYGPAFSGYGQ
QDSQEFLLFLLDGLQEDLNRIHKKPYIEKPDSTDDMVHDKAALQEFADRNWEIYKARNDS
VITDLFAGMYKSTVVCPACDKVSIIFDPFSNLTLQLPIENVWSKYVYFFPAHGEPLLIDV
EIDKNASIKALKEYVAKKVNSDPRRLVMAEIYTQKIYKLFSNTSAISDCSIGQSDNIAMY
ELETIPTSYDPDKAKRQSYSMLYTGLRGDDADIVSFDSEQADRILVPIFNRVVKTSVTKY
ARQRPLFGVPRFAVITREEAMDYDAILRKVLAQVNTLTTRDILTEDEDDTTMRSTSAEDS
DAVVTNDDDASSNDSKIKMGSVEGEDGLVDVSMRDATDPSSQGGSTNPSNAPVARVLQPR
SFIPPSLRNLFDVKFVKTQDPAGIAYSSIDDSKEFLSMIDRVRPRKAAKRGGQRMKTVPP
HRSNNSPVSSEDELSRPPISVQVPRNKLTERLSNYSSSEETKEDSGSDTDSDPYPTARSI
RKEKGHNQKGVGSKRGPPSNLPYIRPGEAIVLDWTESAHDALFGGDPRDKESLRGIPTWE
NPQRLPDPELARKRQLRQSKKRMGISLAECLDEFGREEILSENDAWYCPRCKEHRRASKK
FELWTVPDILVMHLKRFSANRGFRDKLDVLVDFPLELDMSGRAQAPNDGKSMMYDLIAVD
NHYGTLGGGHYTAYAKSFADGNWYEYNDSHTSRKSDPSVVVTKAAYLLFYRRRSDHPLGG
SYLAQVIEAAGQKNAADSDSPEDSDGNSGEGKRLDGSSRNGSSSALAGVAAAHQAGDGGL
QGGVLNRNDEDDTLPGYLDSIQAGESSLRRGDDLEGMEIDGYEREYGPGPLSYLRDQGWS
FDRIHAGSYYGNNDDLDDNSSMKAVGGDDTDSETQIQPLGSSEGPAPLFSGNDYDNEHVS
ILGMMDVDEDDEMPVVELSVPDEESSS
NT seq 4584 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcaacgggcggtgcgaacgggaagtccaccagctgcgatcagccgatgcaagac
gctcaaaacggccatcctgactaccgatcttcttctcctacattaaagcgcccggctgca
gagatgggtggggacgaacagaaggagaacggggattctatggatacagatcctccgagc
agcaagagcattatcgaaatccaggtagacaactcacacctgaaaaagaagaatgatcgg
ccagacaggcacgcccgggcagcttccgttgatatgatcggtcgggataacgatacaggc
cccaaaacctcatctgaagaggctaccagctccggatcggatagcgtctatccaacccca
tccagcatgtcgacctacacccactcaacctacgaggagagatcccaggcgatctcaagc
cattccaaccactcttcgcacgctgttccttcccttgacgaacaggttgcaaccgtcatg
caaatggtgatgcagcctccacaagaaaaacagcgaggatatgtggtctctgggacttgg
ttaaatagggttctcgcgaggagtagcaaaggtccgatgcgggacaaatctgacaaaact
gctgcagagggtgagataggaccagtcgacaactccgatcttgttctggtcaccgatcct
agcacgctattcaaggatgaagccggagagccgttcgttccgcttcgccccggtttacaa
atgggagaggacttcgagatcttccctcaagaagcatgggatctgattataagctggtac
ggcttgtcaaagaattccccagcgattgttcgatacgcacataacacaaatacccccgga
aatactgagaacatccaatacgagctgaatccgcctgtatttacaatcctaaagttgccg
agtccgacaaaccctgctgtgcaactttcgacagataaaagtcggactcctgttaagacg
cttgccagcagccacactccattccagcaatggctaagaaatgctaagaaacttgcttct
atccagcccacaactaaggttcgcgtatggaggatccttgagggtttggggacctctggt
accgttacgccagccgcttcccgaagtgcttcgccagctccgggctccaccctaattgcc
aacgctggggacagcttagttctcgacactaacaagtttgtcgccttgagtgaaggctcg
cagagggaacttgttgaactcaaagaccagacttcgaacgaaaaatataacggaagtgtt
acattgcaccttgctggccttagtggtgacaatgttattgttcttgaagagcaaatcggt
ggcgctggtggtggcgaatgggcatcagatgccgcaaagtatgggtcaagccgactcgct
gctctgaccaccaccacaaccactacaaaggtagcaccccagagcaagttcaaatcaccc
gccgttcctactagtggacgtgcgtcacccgtaccatccgtcgttacgcgagggcgaaag
cgcaaagatggcaaaactcgtggtgttaccggtctgagcaatctcggaaatacatgctac
atgaattcggctctgcaatgcgtccggagtgtcgaggagctcacccagtatttcctggca
aacgagtataaaaaggacctcaacccgagtaacccgctgtcccacaatggcgatgtagcc
aggacctatgccaaccttctccatcaaatgttcgatgaaaacgcacctgattccatttct
ccccgtagttttaaactgacaatcggacgatatggacctgcattttccggttacggccag
caagactctcaagagtttctacttttcctccttgatggtctgcaggaagatctcaatagg
attcacaagaaaccatatatcgagaaaccggattccacggacgatatggtccatgacaag
gctgcattgcaggaatttgccgatcggaactgggaaatatacaaagcgcgaaacgattca
gtgattactgatctatttgccggcatgtacaaatccacagtcgtttgtcccgcttgtgat
aaagtgagcatcatcttcgatccgttcagcaacctgaccctccaattacccatcgaaaat
gtatggagtaaatacgtatatttcttcccggctcatggtgagccgcttttgattgatgtg
gagatcgataaaaatgctagcatcaaggcgttgaaggagtatgtggcgaaaaaggtcaac
agcgacccgcggcgtttggtcatggcggaaatctatacccaaaaaatttacaaattgttt
tcgaatacttcggctatcagcgactgttcaatcgggcaatcggataacattgccatgtac
gaattagaaactataccgacaagttacgatccagacaaggcaaagaggcaaagctatagc
atgctttacacgggtttacgcggtgacgatgcggacattgtctcctttgactctgaacag
gcggatcgtatccttgttcctatttttaaccgtgttgtaaaaacctctgtcacgaaatat
gcccgtcagcggccgctctttggcgtgcctaggtttgcggttatcacccgcgaggaggca
atggattacgatgcaatactgcggaaagtcttagctcaagttaatactttaacgacgcgg
gatatcctgaccgaggatgaagatgatacaactatgcgctccacctctgcagaagattcc
gatgccgtggtcacgaacgacgatgacgcgagctccaatgactcgaagattaaaatgggc
tctgtggaaggtgaagacggattggttgatgtctccatgcgtgatgctaccgacccttct
tcgcagggaggtagtacgaacccttcgaacgcacccgtcgccagagttcttcagcctaga
agcttcattcctccctcgcttcgaaacctattcgacgtcaagttcgtgaagacccaggat
cctgcggggatagcatattcttctatagacgattccaaggaatttctctctatgatagat
agggtgcgaccgagaaaggcggctaaacgtggaggtcagcgaatgaaaactgttccgcct
caccgttcaaacaacagccctgtcagcagcgaagacgaactttctagaccgcctatttcc
gttcaagttccgcgtaataagcttactgaaaggttgtcgaactactcgagctctgaggag
acaaaggaggacagcgggtcagacactgattcagatccatatcctaccgcccgctcaata
cggaaagagaagggccataatcaaaaaggagtgggttcaaagcgcggccctccatccaat
ctcccttatatccgtcctggcgaggctattgtgctcgactggaccgaatctgctcatgac
gcccttttcggaggagatccccgagataaggaatcgctgcgtggcataccgacatgggag
aatccccaaaggctcccagatcccgaactagcaaggaaacgtcaactacgtcagagtaag
aagcgcatgggcatctcgttagccgaatgcctagacgaatttggcagagaagagattctc
tccgaaaatgacgcttggtactgtcctcgatgcaaagagcatcgccgtgccagcaagaaa
ttcgagctttggacggtgccagacattttggttatgcatcttaaacgattcagtgccaac
cggggattcagagataaattagacgtgctagtcgatttcccccttgaactagatatgtcc
ggaagagcccaagcgccgaatgacggcaagagcatgatgtacgacttgattgccgtcgat
aaccactatggtaccctgggtggtggccattacacggcttacgccaagagctttgctgat
ggtaattggtatgaatataatgattcccatacgtcgagaaagtcagatcccagcgttgtt
gtgacaaaggcagcgtacctgttattctaccgtcggcgctcggatcaccctttaggcggg
tcgtatctggcgcaggtaatagaggcagcaggtcaaaaaaacgcagcagactctgattct
cccgaagactctgacgggaattcgggggaaggcaagcgcctcgacggctcctcccgcaat
gggtcgtcgagcgccttagccggagtcgcagcagctcaccaagcgggagatggtggtttg
cagggcggagtcctcaacaggaatgatgaagacgatacgctgcctgggtacctagattcc
attcaagctggagaaagttctttgagacgtggagatgacttggaaggcatggagattgat
gggtatgaacgcgaatacggcccggggccgttgtcctatctaagagatcaaggttggtca
ttcgatcgtattcacgcaggctcgtactatggtaataatgatgatttggatgataattcg
agcatgaaagccgtcggaggtgatgataccgattccgaaacacaaatacagccgctgggc
agctcggaagggccggctccgctgttctccggcaatgattatgataacgagcatgtgagc
attctgggcatgatggatgttgacgaggacgacgagatgcccgtggtagaactttcagtt
ccagacgaagagtccagcagttga

DBGET integrated database retrieval system