KEGG   Coccidioides posadasii: CPC735_068100Help
Entry
CPC735_068100     CDS       T01332                                 

Definition
(RefSeq) cytochrome c, putative
  KO
K08738  cytochrome c
Organism
cpw  Coccidioides posadasii
Pathway
cpw00920  Sulfur metabolism
cpw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CPC735_068100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 CCP_MauG Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 9696767
NCBI-ProteinID: XP_003071273
UniProt: C5P0C0
AA seq 112 aa AA seqDB search
MGKDGYAPGDAAKGANLFKTRCAQCHTLEKGGANKVGPNLHGLFGRKTGQAEGFSYTDAN
KQKGITWDHETLYVYLENPKKYIPGTKMAFGGLKKAKDRNDLITYMEQECTK
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggacggctacgctcccggtgacgccgccaagggtgccaacctcttcaagacc
cgctgcgctcaatgccacaccctcgagaagggcggtgccaacaaggtcggccccaacttg
cacggtctcttcggccgcaagaccggtcaggctgagggcttctcctacaccgacgccaac
aagcaaaagggtatcacttgggaccacgagactctctacgtctacctcgagaaccctaag
aagtacattcccggtaccaagatggccttcggtggtctcaagaaggctaaggaccgcaac
gacttgatcacctacatggagcaagagtgcaccaaataa

DBGET integrated database retrieval system