KEGG   Coccidioides posadasii: CPC735_068260Help
Entry
CPC735_068260     CDS       T01332                                 

Definition
tryptophan synthase, putative (EC:4.2.1.20)
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
cpw  Coccidioides posadasii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CPC735_068260
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CPC735_068260
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CPC735_068260
Enzymes [BR:cpw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CPC735_068260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 723 aa AA seqDB search
MEGIKQTFAQCKREGRSALVAYVTAGYPRPDETVDIILGMEEGGADIIELGVPFTDPIAD
GPTIQRANTQALQHGVTITSVLEMVRQARDRGLRAPVLLMGYYNPLLRYGEEKILKTAKA
AGINGFIMVDLPPEEAVRFRDLCKKEGLSYVPLIAPATSDSRMRLLCSIADSFIYVVSRM
GVTGATGRLSTGLPELLARVHSYSGNIPAAVGFGVSTREHFLNVQEIAEGVVIGSQMITV
LGEAPEGQRAQKIKEYCSSITGRTVDRSKLSEPFTREIGLTEALAEAQEPTGAQVDKVIK
EGSSPGPGLVDQLEALNVTGNPAAIPARFGEFGGQYVPESLMDCLAELEAGFNEAKNDPK
FWEEYRSYYPYMGRPSNLHFAQRLTEHAGGANIYIKREDLNHTGSHKINNALGQVLLAKR
LGKTRIIAETGAGQHGVATATVCAKFGMECVVYMGAEDVRRQALNVFRMKLLGASVVAVE
AGSRTLRDAVNEALRAWVVDLETTHYIIGSAIGPHPFPTIVRTFQSVIGEETKQQMKELT
GRLPDAVVACVGGGSNAVGMFYPFADDLSVKLLGVEAGGDGIETGKHSATLSGGTKGVLH
GVRTYVLQDEHGQISETHSISAGLDYPGVGPELSSWKDTSRAEFIAATDAQALIGFRTIA
ELEGIIPALESSHAVYGVIELAKKMGKGKNIVLNLSGRGDKDVQSVADALPVIGPKIGWD
LRF
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggagggcataaagcagacatttgcacaatgcaagcgagagggacgctctgcgctggtt
gcgtatgtcaccgcggggtatccccgccctgacgaaaccgttgatatcatattgggcatg
gaagagggtggagccgatatcatcgagctcggtgtgccctttacagatcccattgccgat
ggccccaccatccagcgcgcgaacactcaggcgttgcaacatggtgttactatcacttct
gtgcttgaaatggttcgccaggcgagggatcggggattgagagctcccgtgctgcttatg
ggctactacaacccgctcttgcgatatggcgaggaaaagatactgaaaaccgctaaagcc
gccgggatcaatggcttcattatggttgatctgccaccagaggaagccgttcgatttaga
gatctatgcaagaaggaagggctctcgtatgtccctctgattgcccctgctacctcagac
tcccgaatgagactactctgcagcatcgccgattcttttatctatgttgtgtcgagaatg
ggtgtcactggcgccacgggtcgactaagtacgggccttccagagcttctggcacgagtt
cacagctattccggaaatataccagctgctgttggtttcggcgtgagcacgagggagcat
ttcctgaacgtccaagaaattgcggagggtgtcgttatcggaagccaaatgatcaccgtg
ctgggtgaagcacctgaaggccagagagcccagaagatcaaagagtactgttcaagcatc
acgggaaggacggttgatcggagcaagctgtcagagccgttcacgagggaaattggcctc
actgaggcactggcagaagcgcaggaacccacgggggcacaagtcgacaaagttatcaag
gagggttccagcccaggaccggggctcgttgaccagctcgaggctcttaatgtgaccggg
aatccagctgcgatcccagcacgctttggagagtttggtgggcaatatgttccggagtca
ctcatggattgtctcgctgaactggaggctggatttaacgaagccaagaatgatcctaaa
ttctgggaagaatatcgctcgtactacccttacatgggacgtcccagtaatctgcatttc
gctcagcgcctcaccgaacacgctgggggcgctaacatttacatcaagcgagaagatcta
aatcatacaggaagtcacaaaatcaataacgcactcggccaagttttgcttgcaaagcgt
cttggaaagaccagaatcattgccgaaactggagcaggccagcacggtgtagctaccgca
actgtgtgcgcaaaatttggcatggagtgtgttgtttacatgggtgcagaggacgtccgt
cgacaggcgctcaatgtgttccgcatgaagcttctcggggcgtccgtggtagctgttgaa
gctggctctcggacactccgtgacgccgtcaacgaagcacttcgtgcctgggtcgtcgat
ctcgaaactacacactacatcatcggctcagcgattggccctcatcccttcccgactatc
gttcgtacattccagtcggtaatcggtgaagagacgaagcagcaaatgaaggagctaaca
ggcagactccccgatgccgtggttgcttgtgtcggcggaggtagcaatgctgttggcatg
ttctatcccttcgcggacgatcttagcgtcaaactgctgggtgtcgaagctggaggcgac
ggaattgaaacgggaaagcactcggcgactctctctggaggaaccaaaggtgttcttcac
ggcgtgcgaacctacgttctccaggacgaacacggccagatctccgaaactcactccatt
tcggctggtctagactatcccggcgtcgggccggaattaagttcttggaaagacacctcg
agagccgagttcattgctgccacagacgctcaggctcttattggtttccggactattgcc
gagttggaaggcattattcccgccctggaatcgtcccacgcagtgtacggcgtgatcgag
cttgcaaagaagatgggcaaggggaagaacattgtcctgaatttgagtggccggggcgac
aaggatgtgcagagtgtcgctgatgctttgcccgtcattgggccaaagattggatgggat
ttgagattttaa

DBGET integrated database retrieval system