KEGG   Coccidioides posadasii: CPC735_068260Help
Entry
CPC735_068260     CDS       T01332                                 

Definition
(RefSeq) tryptophan synthase, putative
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
cpw  Coccidioides posadasii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CPC735_068260
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CPC735_068260
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CPC735_068260
Enzymes [BR:cpw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CPC735_068260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 723 aa AA seqDB search
MEGIKQTFAQCKREGRSALVAYVTAGYPRPDETVDIILGMEEGGADIIELGVPFTDPIAD
GPTIQRANTQALQHGVTITSVLEMVRQARDRGLRAPVLLMGYYNPLLRYGEEKILKTAKA
AGINGFIMVDLPPEEAVRFRDLCKKEGLSYVPLIAPATSDSRMRLLCSIADSFIYVVSRM
GVTGATGRLSTGLPELLARVHSYSGNIPAAVGFGVSTREHFLNVQEIAEGVVIGSQMITV
LGEAPEGQRAQKIKEYCSSITGRTVDRSKLSEPFTREIGLTEALAEAQEPTGAQVDKVIK
EGSSPGPGLVDQLEALNVTGNPAAIPARFGEFGGQYVPESLMDCLAELEAGFNEAKNDPK
FWEEYRSYYPYMGRPSNLHFAQRLTEHAGGANIYIKREDLNHTGSHKINNALGQVLLAKR
LGKTRIIAETGAGQHGVATATVCAKFGMECVVYMGAEDVRRQALNVFRMKLLGASVVAVE
AGSRTLRDAVNEALRAWVVDLETTHYIIGSAIGPHPFPTIVRTFQSVIGEETKQQMKELT
GRLPDAVVACVGGGSNAVGMFYPFADDLSVKLLGVEAGGDGIETGKHSATLSGGTKGVLH
GVRTYVLQDEHGQISETHSISAGLDYPGVGPELSSWKDTSRAEFIAATDAQALIGFRTIA
ELEGIIPALESSHAVYGVIELAKKMGKGKNIVLNLSGRGDKDVQSVADALPVIGPKIGWD
LRF
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggagggcataaagcagacatttgcacaatgcaagcgagagggacgctctgcgctggtt
gcgtatgtcaccgcggggtatccccgccctgacgaaaccgttgatatcatattgggcatg
gaagagggtggagccgatatcatcgagctcggtgtgccctttacagatcccattgccgat
ggccccaccatccagcgcgcgaacactcaggcgttgcaacatggtgttactatcacttct
gtgcttgaaatggttcgccaggcgagggatcggggattgagagctcccgtgctgcttatg
ggctactacaacccgctcttgcgatatggcgaggaaaagatactgaaaaccgctaaagcc
gccgggatcaatggcttcattatggttgatctgccaccagaggaagccgttcgatttaga
gatctatgcaagaaggaagggctctcgtatgtccctctgattgcccctgctacctcagac
tcccgaatgagactactctgcagcatcgccgattcttttatctatgttgtgtcgagaatg
ggtgtcactggcgccacgggtcgactaagtacgggccttccagagcttctggcacgagtt
cacagctattccggaaatataccagctgctgttggtttcggcgtgagcacgagggagcat
ttcctgaacgtccaagaaattgcggagggtgtcgttatcggaagccaaatgatcaccgtg
ctgggtgaagcacctgaaggccagagagcccagaagatcaaagagtactgttcaagcatc
acgggaaggacggttgatcggagcaagctgtcagagccgttcacgagggaaattggcctc
actgaggcactggcagaagcgcaggaacccacgggggcacaagtcgacaaagttatcaag
gagggttccagcccaggaccggggctcgttgaccagctcgaggctcttaatgtgaccggg
aatccagctgcgatcccagcacgctttggagagtttggtgggcaatatgttccggagtca
ctcatggattgtctcgctgaactggaggctggatttaacgaagccaagaatgatcctaaa
ttctgggaagaatatcgctcgtactacccttacatgggacgtcccagtaatctgcatttc
gctcagcgcctcaccgaacacgctgggggcgctaacatttacatcaagcgagaagatcta
aatcatacaggaagtcacaaaatcaataacgcactcggccaagttttgcttgcaaagcgt
cttggaaagaccagaatcattgccgaaactggagcaggccagcacggtgtagctaccgca
actgtgtgcgcaaaatttggcatggagtgtgttgtttacatgggtgcagaggacgtccgt
cgacaggcgctcaatgtgttccgcatgaagcttctcggggcgtccgtggtagctgttgaa
gctggctctcggacactccgtgacgccgtcaacgaagcacttcgtgcctgggtcgtcgat
ctcgaaactacacactacatcatcggctcagcgattggccctcatcccttcccgactatc
gttcgtacattccagtcggtaatcggtgaagagacgaagcagcaaatgaaggagctaaca
ggcagactccccgatgccgtggttgcttgtgtcggcggaggtagcaatgctgttggcatg
ttctatcccttcgcggacgatcttagcgtcaaactgctgggtgtcgaagctggaggcgac
ggaattgaaacgggaaagcactcggcgactctctctggaggaaccaaaggtgttcttcac
ggcgtgcgaacctacgttctccaggacgaacacggccagatctccgaaactcactccatt
tcggctggtctagactatcccggcgtcgggccggaattaagttcttggaaagacacctcg
agagccgagttcattgctgccacagacgctcaggctcttattggtttccggactattgcc
gagttggaaggcattattcccgccctggaatcgtcccacgcagtgtacggcgtgatcgag
cttgcaaagaagatgggcaaggggaagaacattgtcctgaatttgagtggccggggcgac
aaggatgtgcagagtgtcgctgatgctttgcccgtcattgggccaaagattggatgggat
ttgagattttaa

DBGET integrated database retrieval system