KEGG   Coccidioides posadasii: CPC735_069070Help
Entry
CPC735_069070     CDS       T01332                                 

Definition
N-acetyl-beta-glucosaminidase, putative
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cpw  Coccidioides posadasii
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cpw00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:cpw00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cpw00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 595 aa AA seqDB search
MRFAYLATLAGSLLAGLAQAVKVNPLPAPQHIKWGDSGPQYLDWNVKYSGPRDRTIIAAW
RRTWGSIVQLRWTPAALEAPIPTFAPFIVGNDKRDAHSNRRILRVSVKVENTNVDLQHGV
DESYTLQIRDKSDSIRITAKTTWGVLRAFTTLQQIVIFKRGRFLVEQPVDIKDYPLYPVR
GIMIDTARNFISVKKIFEQLDGMALSKLNVLHWHITDTQSWPVEVRSYPQMTEDAYSRRE
TYGPSDIRKVIEYARARGIRVVPEIDMPGHSASGWRKIDPDIVACADSWWSNDDWEKHTA
VQPNPGQLDIANNKTYKVVEKVYNDISRIFTDDWFHVGGDELQPNCFLTSKIVRDWLKQG
SRTFNDLLQHWVDKTVPMMKKVKKNRRLLMWEDVLLSGNMHAHRVPRDIIMQSWNGGLAN
IKKLTARGYEVIVSSADFLYLDCGYGGWVGNDPRYNVMENPDPETPNFNYGGNGGSWCGP
YKTWQRIYNYDFTDGLNYAEKKRVIGAIAPLWSEQADDVVISNKMWPRAAALAELVWSGN
VGKDGKKRTTLMTQRILNFREYLVANGIMAAPLQPKYCLKHPHSCDLYYDQTVIM
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttgcttatctcgcgactttggcgggctcgctgctggctggcctggcccaagca
gtcaaagtcaacccgctacctgcccctcaacatatcaaatggggtgactctggacctcaa
tatcttgattggaacgtcaaatacagtggccccagagaccgaacgatcattgcggcatgg
cgtcgcacttggggatctatcgtacagctgcggtggacgccagcggcactagaagctccg
atcccaacctttgcgccttttatagtaggcaacgataagcgcgacgcacattcaaatcga
cgtatccttagagttagcgtcaaggtcgaaaacaccaatgttgatttgcagcatggcgtc
gatgaatcgtatacgttacagattcgggacaagtcggatagtatcaggatcaccgctaag
acaacttggggcgttctccgtgccttcaccactctccagcagatcgttattttcaagcgt
gggcgatttttggttgaacagccggtcgatatcaaggattatcctctctatccggttcgt
ggcatcatgatagacaccgcccgcaacttcatcagcgttaaaaagatttttgagcaactt
gatggaatggccctctccaagcttaatgtcctccactggcatattactgatacccagtcc
tggccggttgaggtccgttcatatcctcagatgacagaggatgcatactcccgcagagag
acatacggcccatccgacatccgcaaggtcatcgaatatgcccgagctcgtggtattcgt
gttgtccctgaaattgatatgcccggtcactctgcctcaggttggcgaaagattgatcca
gatattgtggcttgcgcagattcctggtggtccaatgatgactgggagaaacacacagct
gtccagccaaaccctggtcaactagatatcgctaataacaaaacctacaaggtcgtcgag
aaagtctacaatgatattagccggattttcaccgatgactggttccatgttggtggtgat
gaactacaacccaattgcttcctcacgagtaaaattgtcagggattggctcaagcagggt
tctcgcaccttcaatgaccttctccaacactgggttgacaaaactgtacccatgatgaag
aaagtgaagaagaaccgtcgtcttcttatgtgggaagacgtgcttctctcgggaaacatg
catgcccacagggtcccaagagacatcatcatgcaatcctggaatggtggcctcgctaac
atcaaaaagcttaccgctaggggttacgaagttatcgtttcctctgcagactttctgtat
cttgattgcggttatggtggctgggtcggcaatgatcctcgttacaatgtcatggagaac
cctgatcccgagacacccaacttcaattacggcggtaatggtggctcctggtgtgggccc
tacaagacctggcagcgaatctacaactacgacttcaccgacggactcaattatgccgaa
aagaagcgcgttatcggtgctattgccccgctatggtccgaacaagccgacgatgttgtc
atttcgaataaaatgtggcctcgcgccgcagccctagcggagctggtttggtccggcaat
gtgggcaaggatggcaagaagcgcaccacacttatgacacagcgaattcttaatttccgt
gaatatcttgttgcaaacggtatcatggctgctcctttgcagccaaagtattgtttaaag
catccccattcgtgcgatctttactacgatcaaactgtgatcatgtaa

DBGET integrated database retrieval system