KEGG   Coccidioides posadasii: CPC735_070260Help
Entry
CPC735_070260     CDS       T01332                                 

Definition
Thioredoxin domain containing protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cpw  Coccidioides posadasii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CPC735_070260
Enzymes [BR:cpw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CPC735_070260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 531 aa AA seqDB search
MLKHSSFVVLLTALLGALPASAESLYTKKSPVLQVDATNYDRLIARSNHVSIVEFYAPWC
GHCQNLKPAYEKAAKSLEGLAKVAAVNCDDEANKSFCGIMRIQGFPTLRMVIPSDKPGKP
KHEDYKGPRTAKGIVDAVVEKIPNRVKRLTDKNIDDWLTNSNETAKAILFTEKGTTSALL
RALAIDFHGKIQIGQIRNKETSAVDMFGVTKFPTFVLLPGSDKPSVVYDGELKKKPMLEF
LSQVAEPNQDPPPLKKSSPQKPKKPTTTAGDTATDKPTESANDSTDPREPKKFTASERRS
QAEEPKVPQLRVLSTTTDLRTTCLSSKTGTCILAIVPVPSDPNLPPSMSALQALNSLSDI
ERKHALRHARLFPFYVAPDDIEEVPKLRDELGLKSDIVEIIAINGKRGWWRRYDSADGSK
YGVVDLEKWVDQVRMGEAEKHKIPEGALLSESKEEPKAEPEVIPEQEPEKEPEQEPEQEP
EAPPQDEPEEKTEKEPEHEPEATPSATPETEPQQETTESPKEPKTAVHEEL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaacatagctcatttgtcgtgctgctgactgcgctcttgggagctcttcctgcg
agtgcagagagcctgtatactaagaaatctccagttctccaggtcgatgcaactaactac
gaccgtctcattgctagatctaaccatgtttctatcgtagaattctatgcgccgtggtgt
ggccattgccagaacctcaaaccagcgtacgaaaaggcggcgaagagcttggagggattg
gctaaagttgccgctgttaattgcgacgatgaggcgaacaaaagcttctgtggcattatg
cgtatacagggattccctacgcttagaatggtaattccttccgacaagccaggaaaacca
aagcacgaagactacaaaggcccaagaaccgcgaaaggtatagtagacgctgtcgtcgag
aaaattccaaaccgtgtaaagcgcctcaccgacaagaacatcgatgactggttgacgaac
tcaaacgagaccgcaaaggccattctcttcaccgagaaaggcaccaccagtgcactgtta
agagcattggccattgatttccatggcaaaattcaaatcggtcaaataaggaacaaggag
acttcggctgtggacatgtttggcgtcacaaagtttcccacctttgtcctcctccctgga
tcggacaagccgtcggttgtatatgatggagagttgaagaagaagcccatgctggagttc
ctgagccaagttgcggagccaaaccaagatccaccaccactgaaaaaatcgagccctcaa
aagcccaagaagccgactactaccgccggtgacaccgctacagataagcccaccgagtct
gccaacgatagtacagaccctcgcgagcccaaaaaattcaccgcttcagagagacgttct
caggccgaggagccaaaggtaccacaacttcgtgtgttatccacaacaaccgatctcaga
acgacatgtttgtcctccaagactggaacttgtattcttgctatcgtacccgtacctagc
gacccaaatctacctccatcaatgagtgctctccaagctctaaactctctttcggatatc
gagcgcaagcatgctttgcgtcacgcgcgcctcttccctttttacgttgccccagatgac
attgaagaagttcctaagctccgagacgaactgggcctcaagtctgacatcgttgaaata
attgccatcaacggaaagcgaggatggtggcgtcgatacgattctgccgatggctcaaag
tatggcgttgttgacttggagaaatgggttgatcaagttcggatgggagaggccgagaag
cacaagattcctgagggagctcttctaagcgagagcaaggaggaaccgaaagcggaaccc
gaggtcatccctgaacaagaacctgaaaaggaacctgagcaagaacctgagcaagaacct
gaggcacctccacaggatgagccagaagagaagacagaaaaagaacccgagcatgaacct
gaagcgacaccctcagctacccccgagacggaaccacagcaagagactaccgaatccccg
aaggaaccgaagaccgcagtacatgaagagctgtga

DBGET integrated database retrieval system