KEGG   Coccidioides posadasii: CPC735_070630Help
Entry
CPC735_070630     CDS       T01332                                 

Definition
threonine synthase, putative (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cpw  Coccidioides posadasii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cpw01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cpw00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:cpw00750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 544 aa AA seqDB search
MANNSAGKTHSESQIYLSTRDGDYGLSFETVVLKGLAADGGLFLPHQIPLASDWRSWKDL
SYEELALRIFSLYVSSSEIPADDLKAIIDRSYSTFRAKEVTPLVHLQDNNLYLLELFHGP
SYSFKDCALQFLGNLFEYFLARKNQGKEGKDRHHLTVVGATSGDTGSAAIYGLRGKKDVS
VVILHPQGRVSPIQEAQMTTCLDANVHNVAVTGTFDDCQDIVKALFSDPDTNKTLKLGAV
NSINFSRILAQIVYYFYSYFSLVRKSTTFNLGDQVRFVVPTGNFGDILAGYFAFRMGLPV
DKLVIATNENDILDRFWKTGRYEKKPAQGQEAEGGLEVDGVKAHEGGVRETLSPAMDILV
SSNFERLLWFLAYQSAATGGRDEESNRRQAGREVSAWLKDLKVKGGFGPVSKDVLDSARR
SFESERVSDPQTLDTIKTFYNKVGYILDPHSAVGVTAALRSLERADPNVPHISLSTAHPA
KFAGAVELALKDKEGFNFEAEVLPQEFVGLDKKAKRVITVENDWKVVRELVKKQVKTESQ
AQST
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacaactcggcgggcaagactcactctgagtcacaaatatacctctctaccaga
gacggtgactacggcctctctttcgagaccgttgttttaaagggacttgccgctgatggt
ggtctcttcttaccccatcaaatcccgcttgcatcggactggcggagctggaaagatctc
tcctacgaggagctggccttacggatcttcagcttatacgtatcaagttccgagattccc
gcggacgacctgaaagccataattgatcggagctactcaaccttccgtgcgaaggaggtt
acaccgttggtgcatctgcaggacaacaacctataccttcttgaactatttcacggccca
agctactccttcaaagactgcgccttgcaatttttgggaaacctattcgaatacttcctc
gcgcggaaaaaccagggaaaagaaggaaaagacagacatcatctgacggtagtcggcgcg
acgagcggcgatactggatctgcagcgatttacggtcttaggggtaagaaagatgtatcc
gtggtcatcctacacccgcagggtcgtgtcagccccatccaagaagcgcagatgacaact
tgcttggacgcaaatgtccataatgttgccgtgacggggacattcgacgattgtcaagat
atcgtcaaggctttgttcagcgatccagatacgaacaagactttgaaactcggtgccgtt
aactcgattaacttttcgagaattctcgctcaaatcgtctattatttctattcgtacttc
tctcttgtgagaaagtcaaccaccttcaacctcggtgatcaagtgcgctttgttgttccc
accggaaactttggagatatattggcaggctattttgcgttccgcatgggtcttcctgtg
gacaagctcgtcattgcaacaaacgagaacgacatcctcgatcgcttctggaagacaggt
cgatacgaaaagaagccggcgcaaggtcaagaggcggaaggtggcctggaagtcgatgga
gtgaaagctcacgagggtggtgtacgggaaacactcagtccggcgatggacatcctggta
tccagtaacttcgagcgactcctttggttcttagcgtaccaatccgcagccaccggtggc
agagacgaggagtcgaacaggagacaggcaggccgggaagtcagtgcatggcttaaggac
ctgaaggtaaagggtggatttggccccgtttccaaagacgttctcgacagtgcacgcagg
tcattcgagagcgagcgagtcagcgatccgcagacccttgatacaatcaaaaccttttat
aataaggtcgggtacatcctggaccctcactctgcagtcggtgtcacggctgcccttcgg
tccctggaacgggctgacccgaatgtcccgcacatttcgctttcgacagcccacccagct
aagtttgccggcgccgtcgaacttgctctcaaagataaggagggatttaactttgaggcg
gaggtgttgccgcaagagtttgtcggcctggacaagaaggccaagcgcgtcattacagtg
gaaaatgattggaaggttgtcagagagcttgtcaaaaagcaagtcaagacggagtctcag
gctcaaagcacttaa

DBGET integrated database retrieval system