KEGG   Coccidioides posadasii: CPC735_072530Help
Entry
CPC735_072530     CDS       T01332                                 

Definition
histone deacetylase RPD3, putative
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cpw  Coccidioides posadasii
Brite
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CPC735_072530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 626 aa AA seqDB search
MAGLGPIDLSMTNGAAEKKRVAYFYDSDVGNYAYVAGHPMKPHRIRMTHSLVMNYSLYKK
MEIYRAKPATRLEMTQFHTDEYIDFLSKVTPDNMESFQKEQQRYNVGDDCPVFDGLFEFC
GISAGGSMEGAARLNRGKCDIAVNWAGGLHHAKKSEASGFCYVNDIVLGILELLRFKQRV
LYVDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGELRDIGVGAGRYYAVNVPLRD
GINDISYKGIFEPVIKNVMEWYRPEAVVLQCGGDSLSGDRLGCFNLSMRGHANCVKYVKS
FGLPTMILGGGGYTMRNVARTWAFETGLLVGEQLPTELPYNDYYEYFSPDYELDVRPSNM
DNNNSREYIDRIRKQVIENLKRSAHAPSVQMTDVPRDALVDGMDDEADAILDDLDEDENK
DTRFTKRRFDQYIEKEGELSESEDEEMAAENGVRRQPNGTKRRNQVNYRNLEPESGMNSG
IATPRDASSVADEEVSDTKMDDVGDIDIPDKRSPTPTAEPSTRPESRIETEEPSVPEQQT
APTTENEDKIPVASPPVSPQGSAQPNGDEDTNMEDAIVEPEPSEPPTAPSEPLVATPPKS
PQPEASAQSATSPHPAEPEEGPANAE
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggctggtctcggtcccattgatctttctatgacgaatggagctgctgagaagaaacga
gttgcttatttctacgattccgacgtgggcaactatgcttacgttgctgggcatccgatg
aagcctcatcggattcgaatgacccatagcttggtcatgaattatagcttgtacaagaag
atggaaatctaccgcgccaaaccggccaccaggctagaaatgacacagtttcacactgat
gaatatattgattttttgtccaaagtaacccccgacaacatggaaagctttcagaaagag
cagcagcgatacaacgtgggtgatgattgccccgtattcgacggactcttcgaattttgc
ggcatcagcgccggcggctccatggagggcgcggcgcgccttaaccggggcaaatgcgac
atcgccgtgaactgggccggtggtcttcaccacgcaaagaagagcgaagccagtggcttt
tgctacgttaacgacatcgttctcggaatcctcgagctgcttcgtttcaaacagcgcgtt
ctctatgtcgatattgatgtacaccacggtgacggtgtcgaagaggccttctacacgacc
gatcgcgttatgaccgtctcatttcacaagtacggtgagtacttccccggcacgggcgaa
ctccgcgatattggtgtcggtgccgggaggtattatgcagtgaacgttccgctgcgcgat
ggtataaacgacatctcatacaaaggaattttcgaacccgtgatcaagaacgtaatggag
tggtatcgacctgaggccgtcgtcctccagtgtggcggtgatagtttatcgggtgaccgt
cttggttgctttaacctcagtatgagaggccatgccaactgcgtgaaatacgtcaagagc
tttggactcccgaccatgatcttgggtggcggcgggtacaccatgagaaacgttgcccgt
acgtgggcatttgaaacgggtctgcttgtcggggagcagctgcccaccgaattgccctac
aatgattactatgaatatttttcgcccgattacgaactggatgttcggccatccaatatg
gataataataactctagagaatatatcgatagaatccggaagcaggtcattgagaacctg
aagcgttccgcccacgcgccttccgtgcagatgacggatgttccccgtgacgctttggtc
gatggcatggatgacgaggccgacgctatccttgacgatctggatgaggacgaaaacaag
gatacgcgattcacaaagagacgattcgatcaatatattgaaaaagaaggtgaactaagc
gagagtgaagatgaggagatggcagctgagaatggtgtccgccgccaacccaatggcaca
aagcggcgcaatcaagtcaattaccgaaacttagaacctgaatctggaatgaacagtggt
attgccactcctcgcgatgcgtcttccgtcgctgatgaggaggtttctgatacgaagatg
gacgatgttggagatattgatatcccggataagcgctcacctacccccactgcggaacct
tcaactcgacctgaatcaaggatagagacggaggagccctccgttccagagcaacaaaca
gcccccacgactgaaaatgaagacaaaataccggtagcatctcctccagtgtcgccacag
gggtcggcacaaccgaatggtgacgaggataccaatatggaggacgcaatcgtcgagcca
gagccatccgagccgccaacggcccccagcgaacctttggtcgctactccccccaaatca
cctcaacctgaagcttcggcccaatcagccacatctcctcaccccgcagaacctgaggag
ggtcctgcgaatgctgagtga

DBGET integrated database retrieval system