KEGG   Coccidioides posadasii: CPC735_072900Help
Entry
CPC735_072900     CDS       T01332                                 

Definition
histone deacetylase HosA, putative
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
cpw  Coccidioides posadasii
Brite
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CPC735_072900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 492 aa AA seqDB search
MARSTIVQEYGAPPIPNQTLALDAKTANEVEHDIVKRPKGYRVSWHANPAVEPHHFGSNH
PMKPWRLTLTKQLVLAYGMHHAMDLYLSRSATYEEMAEFHSTDYLEFLTQVMPADMESTA
QVETLARFNFGDDCPVFDGLYNYCSLYAGATLDAARKLCNNQSEIAINWSGGLHHAKKSE
ASGFCYVNDIVLGILQLLRIHPRVMYIDIDVHHGDGVEQAFWSTDRVLTVSFHKYDKENF
FPGTGPLDSTGPSHPLNPGAHHSLNVPLNDGIEDNDYIALFKAIIGPCIRTYQPGAIVLQ
CGADSLGCDRLGCFNLNIRAHGACVAYTKTFGLPTLVVGGGGYTPRNVSRLWAYETAICL
EAESDLNPVLPDSLKFRNHFRPDCTLFPPLSEMRKVENKNSKAYLDSLVQSTMEQLRYIK
GAPSVQMSVIPPDILGLREEIEKELEEEKLLGEEEKEDRDGAGVNTLGIGGSRPSRRKDQ
EKGLGVRGELYT
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcccgatccactattgtccaagaatacggcgcgccaccgattccaaatcagacattg
gcccttgacgccaaaactgcaaacgaagtcgaacatgacatcgtcaaacggcccaagggc
taccgtgtatcatggcacgctaatcctgctgttgaaccgcaccacttcggctctaatcac
cccatgaagccatggcgactcactctcacaaagcaactcgttttggcctacggcatgcac
cacgcgatggacttgtatctgtcccggtcggcgacgtacgaggaaatggcggagttccat
agtacggactacctcgagtttctcacccaagtgatgcctgcagacatggagtcaacggcc
caagtcgagaccctcgcccgtttcaactttggcgacgactgcccggtcttcgatggactc
tataactattgctcgctatacgccggtgcaaccctagatgcagcgcgtaaactttgcaat
aatcaatctgaaatcgctataaattggtctggtggcttgcaccacgctaagaagtccgaa
gccagtggtttctgctacgttaacgatatcgttcttggaatcctccagttactccgaatc
cacccgcgggtgatgtatatcgacatcgatgtgcatcatggcgatggagtcgaacaagcg
ttctggtctacagaccgtgtcctcacggtttctttccacaaatacgataaggaaaacttc
ttccccggcaccggacctttagacagcactggcccctcacatccgctcaaccccggcgct
catcactccctgaatgtccctttaaatgacggcatcgaagacaacgattacattgccctc
ttcaaagccattatcggaccctgcatccgcacctaccaacccggcgcaatcgtcctccaa
tgtggtgccgacagtcttggctgcgatcgcctcggttgcttcaaccttaacatccgcgca
cacggcgcctgcgtcgcatacaccaaaaccttcggtctacccaccctcgtcgtcggcgga
ggtggctacacccctcgcaacgtctcgcggctctgggcttacgaaacagccatctgcctc
gaagccgaaagcgacctcaaccccgttcttccggactccctaaagttccgcaatcacttc
cgtcccgattgcacattatttccgcctttgtcggaaatgcggaaagttgagaataaaaat
tctaaagcgtacctggactcgttggtgcagagtacaatggagcaattgagatacatcaaa
ggtgcgcccagtgtgcaaatgagtgtgattccaccagatatattaggcttgagggaggaa
atcgagaaggagcttgaagaggagaagttgttgggcgaagaagaaaaagaagatcgtgat
ggtgcgggtgtcaacacgctggggattggagggtcaagacctagcagaaggaaagaccaa
gagaaaggcttgggggttagaggagagctgtacacataa

DBGET integrated database retrieval system