KEGG   Coccidioides posadasii: CPC735_072970Help
Entry
CPC735_072970     CDS       T01332                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase, putative (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cpw  Coccidioides posadasii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CPC735_072970
   00052 Galactose metabolism
    CPC735_072970
   00500 Starch and sucrose metabolism
    CPC735_072970
   00520 Amino sugar and nucleotide sugar metabolism
    CPC735_072970
Enzymes [BR:cpw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CPC735_072970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 523 aa AA seqDB search
MASRAIPSHLRAPNTESRSAEERSFVRHHGKSQSHMAFEHASTNVAASQMRNALNALSDT
VKDPSEKKRFEAEMDNFFSLFRRFLNDKAKGNVLSWDRIAPPQPNQVVEYSELSNSASVD
YLKKLAVIKLNGGLGTSMGCVGPKSVIEVREGMSFLDLSVRQIEYLNRTYNVNVPLVLMN
SFNTDDDTQSIIKKYEGHNIDIITFNQSRYPRVLKDSLLPAPKDYSSPITDWYPPGHGDV
FESLYNSGTLDKLIERGVEIVFLSNADNLGAVVDMRILEHMVTNNSEYIMELTDKTKADV
KGGTIIDYEGKARLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWLNLRAIKRVVEESALEM
EIIPNEKSIPADKKGEADISIIQLETAVGAAIRFFKGAHGVNVPRRRFLPVKTCSDLMLV
KSDLYTLQHGQLVIDPNRFGGAPLIKLGTDFKKVSDFQKRIPSIPRILELDHLTISGAVN
LGRGVTLKGTVIIVATEGSTIDIPPGSILENVVVQGSLRILEH
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggccagcagggcaattccatcgcaccttcgcgctccaaacaccgagtctcgctccgcc
gaggaaagaagcttcgtcaggcatcatggcaagtctcagtcacacatggccttcgagcat
gcctccaccaacgtcgcagcttcgcagatgcgcaacgccctcaatgccctctcggacacc
gtcaaagaccccagtgaaaagaagcgtttcgaggctgagatggacaacttcttctccctc
ttccgcagattcttgaacgacaaggccaagggcaatgttctctcctgggatcgcattgcc
ccgcctcagccaaaccaggttgtcgagtacagcgagctcagcaactccgcttcggtcgac
tacctcaagaaactggccgtcatcaagttgaatggtggcctcggtacttccatgggatgc
gttggtccaaagtccgtcattgaagtgagagaaggcatgtccttcctcgacctctccgtc
aggcagatcgagtacctcaaccgtacttacaacgtcaacgttcctctcgtcctgatgaac
tccttcaataccgacgacgacacccagtcaatcatcaagaaatacgagggtcacaacatc
gatatcatcacattcaatcaatcacgctacccgcgtgtcctcaaggactctcttctccca
gcacccaaggactactcctctccgatcacggattggtatccccccggccacggagacgtc
tttgagtctctctacaactctggaacccttgacaagttgatcgagcgtggtgtcgagatt
gtcttcttgtccaatgccgacaacctcggagcagtcgtcgatatgcgcattttggagcac
atggtgacgaataactctgaatacattatggaactgaccgacaagaccaaggcagatgtc
aagggtggcaccatcatcgactacgagggcaaggctcgcctacttgaaatcgcccaggtt
cccaaggagcatgtgaacgagttcaagtcgattaagaaattcaagtactttaataccaat
aatatctggctgaacctccgcgccatcaaacgcgtggtggaggagagtgctcttgaaatg
gagatcattccaaacgaaaagtctatccctgcagacaagaagggagaagcagatatttcc
atcatccagctggagactgctgtcggtgcggcaatccgtttcttcaagggtgctcatggt
gtgaacgtccctcgtcgccgtttcttgccagtgaagacttgctccgatctcatgctggtc
aagtctgacctgtatacacttcagcatggccagctggtcattgaccctaaccgattcggc
ggtgccccactcatcaagttgggcaccgacttcaagaaagtttcagatttccagaagcgc
atcccgagtattcctcgcatcctggaacttgaccatcttactatcagtggagccgtcaac
ctgggacgcggcgttacgctcaagggtacggtcattattgtagctacggagggaagcacg
atcgatatcccaccagggtcgattctcgagaatgttgtcgtgcagggaagtttgcgcatc
ctggagcactag

DBGET integrated database retrieval system