KEGG   Coccidioides posadasii: CPC735_073380Help
Entry
CPC735_073380     CDS       T01332                                 

Definition
glycosyl hydrolase, putative
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cpw  Coccidioides posadasii
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cpw00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cpw00312]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 937 aa AA seqDB search
MAAAREEESLPEWDCNELDRQMGQLFVMGFDGTSVDPQIRSLIEDYRLGSIILTAKNLKS
AEETTKLVLELQTIARDAGHPAPLMIGLDQENGGVNSLFDEIYIRQFPSAMGIAATGSKS
LAREVAKATAQELSAVGVNWILGPVLDVLNNARSQPLGVRSIGDDAQEVSAYGVEFMKGY
QEAGLVTCGKHFPSYGNLEVLGNQTDVPVITDTLEQLSMSALVPFRNAIAQGIDSMMVGG
CAMSSAGVNVMHACLSEQVVDDLLRKDLNFNGVVVSECLEMEALSFNIGVGGGTVMAMKA
GCDLILLCRSFSVQQEAINGLRLGVENGIINKERIRQSVQRVLDMKARCTSWEKALNPAG
ISLLSQMQPSHTNLSTRAYNSSITIVRDKNNLLPLTSVLEPDEELLLLTPLVKPLPASAV
SLSITESSRETVLSTDTVSWERSASVMSGESVFREFGRSLARHRNGRVLHTSYTANGVRP
VHENLINRASGVIVVTADSNRNLYQYGFTKHVAMICNAQFAANGDRRSKPLVVVAVSSPY
DFATDQSIGTYVCTYDFTETALQALVKVLYGDLTATGVLPGTLSRSQKLHQSRQHWLVEN
WNEDRDANALDELLTAIREDSTHNQRSALAGVTSNTFLLRNSDVEEAHFVVRNSSTQALY
GFCSTYFFKSTGTAVIGALIVDPGRRKLSIGNSLHNRAIRSLMQRQGVRRFQLGSRLPGV
YLGIPTGNPVERKRLRQWFASLGWNTSLSRPVCTMILPNLGEWTPPEGLTRTLKSAEVSY
DLVYGLDYAEAILDHVKTNSRQGVMEIYKMALSGSSANGIIRAKRNGDDAILGTVVVYTS
ESTLAEFVPTVKEARPMGGGISSAVISPSAGEYSTIVQGLILLGIKQLRSQGASAVVLDC
VDGDGNFDGLSAMGFSTLHSFEEVTCDAATWNMLTSS
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggctagggaggaagagtcgctcccagaatgggactgcaacgagctcgacagg
cagatgggccagctctttgtcatgggctttgatggaactagcgtcgatccccagatccgg
tcacttatcgaggactatcggcttggttcgatcattctgactgccaagaatcttaaatcg
gcagaagaaaccacaaagctcgtgttagagcttcagactattgcccgggatgctggtcac
cctgctccactcatgattggcctcgatcaggagaatggaggcgtcaacagtcttttcgat
gagatctatatccgccaatttccgagcgctatgggaatcgcggctactggatcgaagtct
ctggcaagggaagttgcgaaagccactgctcaagagctcagtgctgtcggagtcaattgg
atccttggtccggtcctggatgtcttgaacaacgcaagaagtcagcctttgggagtcaga
agtatcggggatgatgctcaagaggtatcagcctacggtgttgagttcatgaagggctat
caggaagcgggcttggttacttgtgggaagcactttccatcttatggaaaccttgaagtg
ctaggaaaccaaacggacgtccctgttatcacagacacgcttgagcagctcagcatgagt
gcccttgtcccttttcgaaacgcaatcgcacaggggattgattctatgatggttggtggt
tgcgcaatgtcatcggctggggtgaacgtgatgcacgcttgcttgtccgagcaagttgtc
gatgacttgcttcggaaggacctcaacttcaacggcgtcgtggtctctgaatgcctggaa
atggaagcgctcagtttcaacattggagtaggaggaggaacggtaatggcgatgaaagct
ggctgcgacttgatactcctttgccggtcattctcagttcagcaagaagcaatcaatggc
ttgagacttggggttgagaacggtatcatcaataaagaacggatcaggcaatcagtgcag
agagttcttgacatgaaagcccgctgtacatcgtgggagaaggcattaaaccctgccggc
atcagtcttctctcccaaatgcaaccatcccacaccaatctatccaccagggcctataac
agctccattaccatcgtcagagacaaaaacaacctccttccactcaccagcgtcctggaa
cccgacgaagagcttctccttctcacacctttagtcaaacctttgcccgcatctgctgtg
tccctctcaatcactgaaagtagcagagaaaccgttctttccacagatacagtctcctgg
gagcgcagtgcgtctgtcatgagcggggagagcgtttttcgcgaatttgggcgctcgcta
gctcgacatagaaacggtcgcgttctccatacatcatataccgccaatggagttcgccca
gtccacgaaaatcttattaatcgcgcaagcggtgtcatcgttgtcaccgctgactcgaac
cgaaacctctatcagtatggcttcacaaaacatgttgccatgatatgcaatgcacagttt
gcagcaaatggagataggcgttccaaaccacttgtagtagtggcagtgagctcaccttat
gactttgccacagatcagtccattggaacatatgtgtgcacatacgattttacagaaaca
gctcttcaggcgttggtcaaggttttgtacggagatttgacggctaccggcgttcttccc
ggcaccttgagccgcagccagaagcttcaccagtcaaggcagcattggcttgtagaaaat
tggaatgaggatcgcgatgcgaacgcattggacgaactgctcaccgctatccgcgaagac
agcacgcacaaccaacgatcggctcttgcaggtgttacatccaatacattcttgttacga
aattctgatgttgaagaggcgcattttgttgtcaggaatagcagcactcaggcgctgtat
gggttctgctcgacatacttcttcaagtccaccgggactgctgtaattggcgccctgatc
gtcgatccggggaggcgaaagctgtcgattggaaactctttacacaatcgtgcaattcga
tcattgatgcagagacaaggcgtgaggcgattccagttgggctcacggctcccaggtgta
tatcttggtattccgacaggaaacccagtagagagaaaacgtctccgtcagtggttcgcc
agtctgggttggaatacgtctttatccagacctgtttgcacaatgatcctgccaaatctg
ggggagtggacaccaccagaaggccttactcgaactttgaagagtgcggaagtgagttac
gatctggtttatggcctggactatgcagaagcaatcctcgatcacgttaagacgaattca
cggcagggagttatggagatatacaaaatggcgttaagtgggtcttctgcgaatggaatc
attcgcgctaaacggaatggcgatgacgctatcttggggactgttgttgtgtacaccagt
gaatcgacgctggccgaattcgttcccacagtgaaggaggcgcgtcctatgggtggagga
atctcctcagcggtcatctccccttctgccggggagtattcgaccatcgttcaaggcctg
attttactgggaatcaagcaattacgtagccagggggccagtgcggtggttctggattgt
gtggatggagacggcaatttcgatggtctgtcggccatggggttctctacgctccacagc
ttcgaggaggtgacctgtgatgcggccacctggaacatgttgacttcgtcatga

DBGET integrated database retrieval system