KEGG   Coccidioides posadasii: CPC735_073670Help
Entry
CPC735_073670     CDS       T01332                                 

Definition
Phosphatidylinositol 3- and 4-kinase family protein (EC:2.7.1.137)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
cpw  Coccidioides posadasii
Brite
Protein kinases [BR:cpw01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   CPC735_073670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2379 aa AA seqDB search
MSQSSSATDALPKLFLELKSKNEETRLRAATELYDNVVAASRELPQDKFLEYYNTVSQRI
AQLVVTGGDANEKVAGLLALDRLIDFDGVDAALKTTRFSGYLRSALRSNDNAVLLYAARS
LGRLAKPGGALTAELVESEIQSALEWLQSERQENRRFAAVLVIRELAKGSPTLIYGFVAQ
ILELIWVAIRDPKVLIRETSADAISECFEIISARDSQVRHQWFAGIYDETLLGLRSTNVD
WIHGSLLALRELLLKGAMFMNEHYRNACEIVLRLKDHRDPKIRTQVVATIPVLASYAPLD
FTNTYLHRFMIYLQAQLKREKERNAAFIAIGKIASAVGNAIGQFLDGIIVYIREGLTLKA
RNRAAVNEAPMLECLSMLSMAVGQTLSKYMESLLDPIFACGLSKALTQALVDMAHYIPPI
RATVQEKLLDMLSLVLCGRPFQPLGCPDNRAPPMPSFVKESAPPPQEVTDSEITLALLTL
GSFDFSGHILNEFVRDVAIKYVDNDNSEIRKASALTCCQLFVHDPILNQTSSHSLQVVSQ
VIDKLLSVGVGDPEPEIRCTVLQSLDRKFDRHLAKPENVRCLFLAVNDEVFSVREAAISI
IGRLSNVNPAYVFPPLRKLLVNLLTGLSFATTSRQKEESAQLISLFVTNATKLVRSYVDP
MVTTLLPKTTDLNAAVSATTIKAIGEIATIGGEGMKQYLAQIMPIILEALQDLSSPSKRE
AALRTLGQLASNAGYVIEPYKEYPQLLAVLINIIKTEQAGSLRKETIKLIGTLGALDPYK
YQQISQDTPDVHHINEIQAVSDVSLIMQGLTPSNEEYYPTVVINTLLHNILSESSLAQYH
SAVIDAIVTIFKTLGLKCVPFLGQIIPAFISVIRDTPVSRLDTYFNQLAILVTIVRQHIR
AYLPEIIVVIREYWDASYQVQATILSLVEAISKSLEGEFKKYLAGLIPLMLETIEKDSSP
RRQPSERVLHAFLVYGSSAEEYMHRIVPAIVRLFDKQQAPQNIRKSAIETLAKLSRQVNV
SDFASLMIHPLARAIGSSDRTLRQSALDCVCTLIFQIGQDFTNYIQLINKVLKNNQIHHH
NYQILVSKLQKGEPLPQDLNPDEQYGSFGDDQSFGEVGQRKILVNQQHLKNAWDATQKST
REDWQEWMRRFSVELLKESPSHALRACASLAGIYQPLAKDLFNAAFVSCWTELYHTYQEE
LVHSIDLALTARNIPPEILQILLNLAEFMEHDDKALPIDIRTLGKYAGKCHAFAKALHYK
ELEFEQDQNSGAVEALISINNQLQQFDAAIGILRKAQAYRDVELKETWFVKLQRWEEALA
AYKRRELIDPDSFEVTMGKMRCLHALGEWKMLSDLAQEKWNQATNDHRIAIAPLAAAAAW
GRGQWELMDSYIGVMKEQSPDRSFFGAILSLHRNQFKEAAEYIEKARNGLDTELSALLGE
SYNRAYNVVVRVQMLAELEEIITYKQSVGDLEKQEAMRQTWNKRLLGCQQNVEVWQRMLK
VRALVISPRENLDMWIKFANLCRKSNRMGLAERSLASLEAVESSEFGIPPEVTYARLKFD
WAAGRQQEALQALKDFTASLTEEYGKYNSLVSAARGQQQQAAENNHMSNGQTEQREAEIA
AIRQHLGDLGKFRRLLAKSHLKQGEWQTALQRGDWRSENVCDVLNAYSAATHYNRESYKA
WHAWALANFEVLNALSPQSNNETVSIPHHIISEHVVPAIQGFFRSIALSSSSALQDTLRL
LTLWFTHGGDADVNSVVTDGFATVSIDTWLEVTPQLIARINQPNPRVRAAVHRLLADLGK
AHPQALVYPLTVATKSNVVRRSQSAIHIMDSMRQHSPRLVEQAEVVSHELVRVAVLWHEL
WYDGLEEASRLYFANHNVEGMFATLAPLHDMLDKGAETLREVSFAQAFGRDLAEARHFCL
LYRETQEIGDLNQAWDLYYTVFKKIDRQVRHMRTLDLKYVSPKLKDAVDLDLAIPGTYQS
GKPVIRILSFDPVLTLVQTKKKPRKMIVKGSDGNSYMYALKGHEDIRQDERVMQLFGLVN
TLLEKDSECFKRHLTIQRFPAIPLSQNSGLIGWVTNTDTLHALIKEYRESRRILLNIEHR
IMLQMAPDYESLTLMQKVEVFGYAMDNTTGKDLYRVLWLKSKSSEAWLERRTNYTRSLGV
MSMVGYILGLGDRHPSNLLLDRITGKIVHIDFGDCFEVAMHREKYPERVPFRLTRMLTFA
MEVSNIEGSYHITCEAVMRVLRENKESLMAVLEAFIHDPLINWRLGARESPAQPSFADRR
QSGELDLDHPLQPGNFTRRRPSILDGGILDAQQGIPNEAREVQNARALQVLGRVREKLTG
RDFKPHEELNVSDQVDKLLVQATSVENLCQHYIGWCSFW
NT seq 7140 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaatcatcatctgcaaccgatgcgctcccgaagctcttcctagagctcaagtcg
aaaaacgaggaaacaaggctgcgagccgcgactgaactatacgataatgtagtagcagcg
tcgagagagctcccgcaggataaattcctcgagtattataacacggtcagccagcgaata
gctcagctcgtggttacagggggcgacgcgaatgagaaggtggccggacttcttgcgctt
gataggttgatcgatttcgacggtgttgatgctgccctaaagacaacgagattctctggc
tacttgcgtagcgcattgaggagtaacgataatgcagtgttgctttatgcagccaggtcg
ctggggcgcctagcaaaacctggcggtgcattaactgcagaattggtggaaagtgagata
caatcggcactagaatggttgcaatcggaaagacaagagaatcgacgctttgctgccgtg
ttggtcatcagggaactcgccaaaggctccccaactctcatctacggattcgttgcccaa
atacttgaacttatctgggttgccatccgtgatccgaaagtgcttatccgagagacgtct
gctgatgctatcagcgaatgctttgaaattatttcggctcgagatagccaggttcgccat
cagtggtttgcgggaatctacgatgagacgctacttggtctaagatcaacgaacgtggat
tggatccatggctctctccttgcgcttagagaattgctccttaaaggggccatgtttatg
aacgagcactaccgcaacgcttgtgagatagttctacggctgaaagaccaccgagacccc
aagatccggacccaagtggtcgctacaatccccgtgcttgcatcatatgctccattagac
tttacgaatacttatctccatagattcatgatatacctacaggcgcagctaaagcgagag
aaagagcggaatgccgcgttcatcgctatcggtaagattgctagtgctgtggggaacgcg
attggtcagttcctcgatggcatcattgtgtatattcgtgagggcttgactctgaaagca
cgcaatcgtgctgcagtgaacgaagctccaatgctagaatgcctgagcatgctatctatg
gccgtggggcaaactctcagcaagtatatggaatctcttctcgaccctatctttgcctgt
ggcctgagtaaagctctcactcaagctctagtcgatatggcacattatattccgcctatc
agagccacggtccaagaaaagctgctcgacatgttaagtttagttttgtgtggaaggccc
ttccaaccccttggctgccctgacaatcgcgccccgcctatgccgtcttttgtgaaagaa
tctgcaccgccaccccaagaagtcactgacagcgagattacccttgccctgctaacacta
gggagcttcgacttctctggccatatattgaacgagtttgtccgcgatgtggctataaaa
tacgtggacaatgataactccgagatccgcaaagcatccgccttgacttgttgtcaactg
tttgtccatgaccctattctcaaccagacaagcagccattctctccaggttgtcagccag
gttatcgacaagctcttatctgtaggagttggtgaccctgaacccgaaatccgctgcacg
gtattacaatcactggatcgaaaatttgatcgtcatttagccaaaccggaaaatgttcgc
tgcctttttctagctgtcaatgatgaagtgttctccgttcgagaagcagcaattagtata
attggtcgtttatcaaacgtcaatcctgcttacgttttcccaccgttgcgaaagctgctt
gtcaatcttctaacggggcttagttttgcaacgacgtcccgtcaaaaggaagaaagtgct
cagttgattagtttgtttgtcacaaatgcaaccaaattggttcgctcctacgttgaccca
atggtcacgactctattgccgaagacaacagacctcaatgccgcagtgtcagctacgacc
ataaaagcaatcggagaaatcgcaaccattggcggtgagggcatgaagcaatacctggct
cagattatgcctattatattggaagctttacaagatctgtcctcgccctcaaaacgagag
gccgctttgcgcactcttggacagcttgcgagcaatgccggctacgttatcgagccctat
aaggaatacccacaactccttgctgtcctcattaacatcatcaaaacggaacaagccggg
tctcttcggaaagaaactatcaagctcattggcaccctaggagctctcgacccctacaaa
tatcagcaaataagccaagataccccagacgttcatcacatcaatgaaatccaagcagtg
tccgatgtgtcactaatcatgcaagggcttaccccttctaacgaggaatactatcctaca
gttgttatcaataccctactacacaatatcctaagtgagagttcccttgcccaatatcac
tccgccgtcattgatgctatcgtcacgatctttaagactttgggcctgaaatgcgttcct
ttcttgggacaaataatcccagctttcatttcggtgatcagagatacgccggtcagccgc
ctggatacctacttcaaccagcttgcaatattggttacaattgtcagacaacatattcgc
gcatatctgccagagattattgttgttatccgcgaatattgggatgcgtcctatcaggtc
caggcgacaatactgtctcttgtggaagcaatatccaagtctctggagggagagttcaag
aaatatttagccggattgatccccctgatgctagaaacaatcgaaaaggacagtagtcca
cggcgccagccatcagagagggttttgcatgcatttctcgtgtatggatctagcgcagag
gaatatatgcacagaattgtcccggcgattgttagattgtttgataaacagcaggctccc
caaaacatcaggaagtcggccatcgaaactctggcgaagctgtctcgccaagtcaatgtg
tctgactttgcatcccttatgatccatccattggcaagggcaatcggctcaagtgaccgc
actttgagacaatctgctttagattgcgtttgcaccctaatttttcagataggtcaggac
tttacgaattacatccagttgatcaacaaggtgctcaaaaataatcaaattcaccaccac
aactaccagatcctcgtatcgaagctccagaaaggcgaacccctaccccaggacctgaat
cctgacgagcaatacggttcttttggtgacgaccaatcctttggagaggttggtcaaaga
aagatccttgtaaaccagcagcatctcaagaatgcgtgggatgcaactcaaaaatcaact
cgagaagactggcaagagtggatgagacgtttcagcgtagagcttcttaaagaatccccg
tctcacgcccttcgggcttgcgccagcttggcgggtatttaccaaccattggcaaaggat
ctgttcaatgccgcatttgtgtcatgttggactgagctttaccatacttatcaagaagaa
ctagttcactcaattgaccttgcccttacggctcgaaatataccgccggaaattcttcag
attcttcttaatttagcagagttcatggaacatgacgacaaagcacttcctattgatatc
cgcactcttgggaagtatgcaggcaaatgtcacgcttttgcgaaggccttgcattataaa
gaacttgaatttgagcaagaccaaaactccggcgctgttgaagctttgattagtatcaat
aatcagcttcagcagttcgatgcggcgattgggattctccgcaaagcgcaagcatatcga
gacgtggagctaaaggagacgtggttcgtaaagcttcaacgttgggaggaagctttagcc
gcgtataagcgacgtgaattgattgatcctgattcttttgaagtcaccatgggaaagatg
cgctgcttgcatgctcttggggaatggaagatgctttcggatttggctcaagaaaaatgg
aatcaagcgaccaacgaccaccggatagctatcgcgcctcttgccgcagctgctgcttgg
ggccgtgggcaatgggaactcatggattcatacatcggagtaatgaaggaacagtcgcct
gatcgatcgttctttggtgcaatcctttccttgcatcgaaatcagttcaaagaagcggca
gaatacattgagaaagcccgcaacggtcttgacacggagctatctgcactgctaggtgaa
tcttataatcgtgcttacaatgtggtcgtccgtgtccagatgctggctgagctcgaagaa
atcattacttataagcagagtgttggtgatcttgagaagcaagaggccatgagacaaaca
tggaataagcggctcctaggttgtcaacagaacgttgaagtatggcaacgaatgcttaaa
gtcagagcgcttgttatttcgccaagggaaaatttggatatgtggatcaagtttgccaat
ctctgtcgaaaatcgaatcgaatgggacttgcagaacgctctctcgcgtccctcgaagcc
gttgaatcttccgagtttggaattccaccagaggtgacttatgctcgccttaaatttgac
tgggccgcaggccgccagcaagaggccctgcaagcactcaaagactttactgcctctttg
actgaagaatatgggaaatacaattccctagttagtgccgcacggggccagcagcagcag
gctgcagaaaataaccatatgtctaacgggcagacggaacaaagagaagcggagatagct
gcaatccgtcaacaccttggcgaccttggcaaattccggcggcttcttgcaaagagccat
ctcaaacaaggcgaatggcagacagccttacagagaggggattggagatctgagaatgtc
tgcgatgtgctgaatgcttattccgccgccacccattacaatcgcgaatcctacaaggcc
tggcatgcttgggcgctcgcaaattttgaggtgctgaacgccctgagtccccagtccaac
aacgaaacagtatcgatacctcatcacattattagcgagcatgtagttcctgctatccaa
gggttctttcggtcgatcgcactttcatcatcaagcgccctccaagacactttgagactt
ctcacactctggttcacacatggtggtgacgcagacgtaaactccgttgtgactgatggc
ttcgccactgttagcattgatacgtggcttgaagtgactccccaacttatcgcacgcatc
aaccaacccaatcctcgggttcgcgctgcagtccaccgcctcctcgcggatctggggaag
gctcatccacaagctctcgtttatcccttaactgtggccacgaaatccaatgtggttcgc
cgttcgcaatccgcgatccacatcatggatagcatgcgtcaacacagtcccaggctcgtc
gaacaggctgaagttgtcagtcatgagctggttagggttgccgtcctttggcatgaactt
tggtatgatggtttggaagaagcatcccgactgtattttgcaaaccacaacgttgaagga
atgttcgcgaccctggcgccactacatgacatgctagacaaaggcgctgaaactctgaga
gaggtgtccttcgctcaggctttcggccgtgacctagccgaagccagacatttctgtctt
ctttaccgtgaaacacaggaaattggagacctcaaccaggcatgggatctgtactacact
gtgtttaagaagattgaccggcaggtccggcatatgaggacccttgatttgaaatacgtt
tcgcccaagctaaaggatgctgtcgacttggatctggccataccaggcacttatcaaagc
ggaaaacctgtgattcgaatcctgagctttgatcctgtattaactctagttcaaacaaag
aaaaagccgcgaaagatgattgttaaaggcagcgatggcaactcgtatatgtacgcccta
aagggtcacgaagatatccgccaagacgagagagtcatgcaactgtttgggcttgtcaat
actctcttagaaaaagacagtgaatgtttcaaacgtcacttgactattcaacgcttccct
gccatccccctatcccaaaactctggtttgataggttgggtaacaaatactgacacacta
catgccctgatcaaagagtatcgggaaagccggcgcattctccttaacatcgagcaccgc
ataatgttgcaaatggcaccagactacgagagtttaactcttatgcaaaaggtcgaagta
tttggttacgctatggataacacgaccggcaaagacctttatcgggttctttggcttaag
agtaaaagctccgaagcctggcttgaacggcggaccaactacactcgctcgctcggtgtt
atgtcaatggtcggatatatcctcggtttgggtgatcgacacccatccaatcttttgttg
gatcggatcacgggcaagatcgttcacatcgattttggtgactgctttgaggttgctatg
caccgcgaaaagtaccctgaaagggttccattccgacttactcgtatgctcacctttgcc
atggaagtcagcaacattgagggaagctaccatatcacctgtgaagccgtgatgcgggtt
cttcgagagaataaagagtctttaatggcagtgttggaagcttttatccatgacccattg
atcaattggcgactgggagcccgcgaatctcccgcacagccatctttcgctgaccgtcgc
caatcaggtgaactcgatctcgatcatccactacagcccggtaactttacacgccgccgt
ccctcgattctagacggtggcattctggacgctcaacagggtattcccaacgaagccaga
gaagtgcaaaatgcccgagctctacaagtgcttggcagagttcgggaaaaactcactggt
cgggactttaaaccacatgaagaacttaatgttagtgaccaggtggacaaacttcttgtt
caagccacaagcgttgagaacttgtgccagcattacattgggtggtgcagtttttggtga

DBGET integrated database retrieval system