KEGG   Coccidioides posadasii: CPC735_073860Help
Entry
CPC735_073860     CDS       T01332                                 

Definition
uricase, putative (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
cpw  Coccidioides posadasii
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CPC735_073860
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    CPC735_073860
Enzymes [BR:cpw01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     CPC735_073860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 309 aa AA seqDB search
METTLAAARYGKENVKVCKVHRDTTTGWQTVTEMTVSVLLEGDIESSYTKADNSVVVATD
SMKNTIYILAKQHPVTSPELFASIIGSHFIEAYKHIHAAHVNIVAHRWTRMAIDGKLHPH
SFMRDGMDVRIADADVIEGKGIEIKSSISGLLLLKSTGSQFHGFIQDEFTTLPETWDRIL
STEIDANWTWMPFENLDHVKSVVPKFDRAFSSARDISLRLFAQDDSASVQNTMYKMASEI
LGTEPLLKTVSYSLPNKHYLELGLSWHKGLKNVGKDAEVYVPTSAPNGLIQCTVARGTDR
YIRATTSKL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggagaccaccctagccgcggcacgatatggaaaggagaatgtcaaggtgtgcaaggtc
caccgtgataccacaactggttggcaaacagtcacggaaatgacagtcagtgtgttgctg
gagggtgatattgaaagctcatacaccaaagccgacaatagcgtcgttgttgcaacggat
tctatgaaaaataccatatatatattggccaaacagcatcctgtcacttctcccgagctt
tttgcgtctattatcgggagtcatttcatagaggcatataaacatattcatgcggcgcat
gtcaatatcgttgctcatcggtggacaagaatggctatcgacggaaagctacacccacat
tcattcatgcgcgatggtatggatgtccgaatcgcagacgccgatgtcattgagggcaag
gggattgaaatcaaatcttcgatctctggccttctccttctaaagagcacaggatcccaa
tttcacggattcatacaagatgaattcaccacgttgcctgaaacctgggacaggatttta
agcacagagattgatgcgaattggacttggatgccatttgaaaacctcgaccatgtcaag
tccgtagttcctaaatttgaccgggccttctcttcggcgcgagatatcagcttaaggctc
tttgcgcaagatgatagcgcaagcgtgcaaaacacaatgtataaaatggctagtgaaatc
cttggcactgagccgttgctgaaaactgtgtcgtactcgcttccgaacaagcattacctt
gaactaggtctgagctggcacaaaggactgaaaaatgttggtaaagatgcagaagtatat
gtgccgacctcggcgccgaatggcttaattcaatgcacggttgcgcgtggaactgaccgc
tacatacgggcgacaacttcaaagctctaa

DBGET integrated database retrieval system