KEGG   Coccidioides posadasii: CPC735_073950Help
Entry
CPC735_073950     CDS       T01332                                 

Definition
(RefSeq) enoyl-CoA hydratase, putative
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00062  Fatty acid elongation
cpw00071  Fatty acid degradation
cpw00280  Valine, leucine and isoleucine degradation
cpw00310  Lysine degradation
cpw00380  Tryptophan metabolism
cpw00410  beta-Alanine metabolism
cpw00640  Propanoate metabolism
cpw00650  Butanoate metabolism
cpw01100  Metabolic pathways
cpw01110  Biosynthesis of secondary metabolites
cpw01130  Biosynthesis of antibiotics
cpw01200  Carbon metabolism
cpw01212  Fatty acid metabolism
Module
cpw_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CPC735_073950
   00650 Butanoate metabolism
    CPC735_073950
  Lipid metabolism
   00062 Fatty acid elongation
    CPC735_073950
   00071 Fatty acid degradation
    CPC735_073950
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CPC735_073950
   00310 Lysine degradation
    CPC735_073950
   00380 Tryptophan metabolism
    CPC735_073950
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CPC735_073950
Enzymes [BR:cpw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CPC735_073950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 9697352
NCBI-ProteinID: XP_003071858
UniProt: C5P068
AA seq 296 aa AA seqDB search
MFSNRCARLVASRTSVPLTSYLARARFSSTASPASAAYEYILTSTPKPGVGLITLNRPKA
LNALCSPLFRELNEALTKYDEDKDIGAIIITGSEKAFAAGADIKEMAPLTFAAAYSNNFI
APWSHLANSIRTPVIAAVSGYALGGGCELALMCDMIYCTSKATFGQPEIKLGTIPGAGGS
QRLTKIVGKSKAMELILTGNTFSGKEAGEWGVAAKVVDGGKDELLAAALETATTIAGYSR
VAVVAAKEVVNKSQELSLGEGVDYERRLFHGLFGSKDQKIGMTAFAEKKKPEWANE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaaaccgatgtgcaaggcttgttgcctctcgaacgtcagtcccattgacgtca
tacctggcccgggcgagattctcttccacagcttctccagcttctgcagcgtatgaatat
atcttgacctctacaccaaagccgggagtgggattgatcactcttaaccgacccaaggct
ttaaacgcactttgcagccccctcttccgtgaactcaatgaagctctgacgaaatatgac
gaagataaagacatcggtgccataatcatcactggcagtgaaaaagcctttgctgctggc
gccgatatcaaggaaatggcacccttaacgttcgctgcagcatactcgaacaactttatt
gccccttggtcccatctggctaactcaatccgcactcccgtcattgccgccgtttctggt
tatgctcttggcggtgggtgcgaattggcactgatgtgtgacatgatttattgcacatcc
aaggcaaccttcggccagcccgagattaaattgggtaccatccctggtgctggtggctct
cagcgtttgactaagatcgttggaaagagcaaggccatggaattgattttgactggaaat
accttcagtgggaaagaggccggagaatggggggtggccgctaaggttgtcgacggtgga
aaagatgaattactcgcagctgcactggaaaccgccaccactattgccggatacagtcgt
gtcgctgtcgttgctgcaaaagaagttgtcaacaagagccaggagctgtcgttgggagag
ggcgttgattacgagagacgccttttccacgggttattcggcagcaaagatcaaaagata
ggaatgactgcgtttgccgagaagaagaagccagaatgggccaatgagtaa

DBGET integrated database retrieval system