KEGG   Corynebacterium pseudotuberculosis I19: CpI19_0880Help
Entry
CpI19_0880        CDS       T01878                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructo kinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cpx  Corynebacterium pseudotuberculosis I19
Pathway
cpx00010  Glycolysis / Gluconeogenesis
cpx00030  Pentose phosphate pathway
cpx00051  Fructose and mannose metabolism
cpx00052  Galactose metabolism
cpx00680  Methane metabolism
cpx01100  Metabolic pathways
cpx01110  Biosynthesis of secondary metabolites
cpx01120  Microbial metabolism in diverse environments
cpx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpI19_0880 (pfkA)
   00030 Pentose phosphate pathway
    CpI19_0880 (pfkA)
   00051 Fructose and mannose metabolism
    CpI19_0880 (pfkA)
   00052 Galactose metabolism
    CpI19_0880 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CpI19_0880 (pfkA)
Enzymes [BR:cpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CpI19_0880 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CpI19_0880 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADO26153
Position
complement(1544430..1545458)
Genome map
AA seq 342 aa AA seqDB search
MRIATLTSGGDCPGLNAVIRGIVRTCSEYGSTVVGYEDGWVGLMEDKRIQLYDDENIDRI
LLRGGTILGTGRLHPDKFKAGLEQIKENLADAEIDALIPIGGEGTLKGAQWLSDSGIPVV
GVPKTIDNDVNGTDYTFGFDTAVSVATDAIDRLHTTAESHNRVMIVEVMGRHVGWIALHA
GMAGGAHYTVIPEHPFDINEICKAMERRFQMGEKYGIIVVAEGALPKEGTMSFAQGCVDQ
FGHQTFNGIGQVIGEEIKRRLGHDVRTTVLGHIQRGGTPTAYDRVLATRYGVHAARACHT
QDFGKMVALHGEHIDLIPLEEAVGTLKVVPAARYRTARALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgcgactttaacctctggcggcgattgccccggactcaacgctgtcatccgc
ggtatcgtccgcacctgttccgaatacggttctaccgttgtgggatatgaggacggttgg
gttggtcttatggaagacaagcgcattcaactttacgatgatgaaaatattgatcgtatt
cttttgcgcggcggaacgatcttgggaactggccgccttcaccccgataagttcaaggca
ggacttgagcaaatcaaagagaatttagcagacgccgaaattgatgctttgattccgatt
ggtggcgagggcacgctaaagggagcccaatggctttctgatagtgggatccctgtggtg
ggcgtgcccaaaactatcgataatgatgtcaacggtaccgattacacctttggctttgac
accgcggtgtcggtagcaactgacgcaattgatcgtttacataccaccgcagaatcccac
aatcgcgtgatgatcgtggaagtgatggggcgtcatgtcgggtggatcgcattgcatgcg
gggatggcaggcggagcacactacactgtgattccagagcatccttttgatatcaatgag
atctgcaaagcgatggaacgccgtttccaaatgggggagaagtacggaattatcgtcgtt
gctgagggggctttgcctaaggaaggaacgatgagttttgcccaggggtgcgtagaccaa
tttgggcatcaaacctttaacggcatcggccaagtgatcggcgaagaaataaagaggcgc
ctaggtcacgacgtacgtactactgtgctcggacacatccaacgcggcggtactccgact
gcttatgatcgtgttttggcaacccggtatggtgttcacgctgcccgtgcttgccataca
caagactttggcaagatggtggcacttcatggtgagcatattgacctaattcctttggaa
gaagcagtaggaactttgaaggtagttcctgcggctagatatcggacagccagagctctc
tttggataa

DBGET integrated database retrieval system