KEGG   Corynebacterium pseudotuberculosis I19: CpI19_1130Help
Entry
CpI19_1130        CDS       T01878                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cpx  Corynebacterium pseudotuberculosis I19
Pathway
cpx00230  Purine metabolism
cpx01100  Metabolic pathways
Module
cpx_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cpx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CpI19_1130 (gmk)
Enzymes [BR:cpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CpI19_1130 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 RsgA_GTPase MMR_HSR1 AAA_25 AAA_22 NTPase_1 AAA_29 Cytidylate_kin CPT Rad17 ABC_tran
Motif
Other DBs
NCBI-ProteinID: ADO26398
Position
1247992..1248567
Genome map
AA seq 191 aa AA seqDB search
MTGDNPKGRLVVLAGPSAVGKSTVVHRLREEVPNLYFSVSMTTRAPRPGEVDGVDYFFVT
PEEFQSRIDGGEMLEWAEIHGGLQRSGTPAGPVEDALLAGRPVLVEVDLIGARNVAALKP
DAETVFLAPPSWEVLVDRLTGRGTEPEDVIKRRLETARQELASQDEFKHVVTNDKVDKTV
AEIRDILLGCC
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcgataacccaaaaggtcggctagtcgttttagctggtccatctgctgtggga
aagtccacggtggttcatcgccttcgcgaggaagtaccaaacctatattttagtgtctcg
atgaccacgagggctcctcgtcctggtgaagtcgatggtgtggattatttcttcgtgact
cccgaggagtttcagtctcgtatcgacggtggagaaatgctcgagtgggcagagatccat
ggtggactgcagaggtctgggactcccgcggggcctgtggaagacgcgttattggccggt
cgtcctgtgctggttgaagttgatcttattggtgctcgtaacgtcgcggcgttgaagcct
gatgcagagaccgttttcctagctccgccgtcatgggaagtccttgtagatcgtcttact
gggcgaggaacggagcccgaagacgtgatcaagaggcggctggaaactgcacggcaggag
ctagcatcccaggatgagtttaagcacgttgtaaccaacgataaagttgataagacggtc
gctgagattcgggatattctgctcgggtgctgctaa

DBGET integrated database retrieval system