KEGG   Corynebacterium pseudotuberculosis I19: CpI19_1441Help
Entry
CpI19_1441        CDS       T01878                                 

Gene name
aceF
Definition
(GenBank) Dihydrolipoamide acyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpx  Corynebacterium pseudotuberculosis I19
Pathway
cpx00020  Citrate cycle (TCA cycle)
cpx00310  Lysine degradation
cpx01100  Metabolic pathways
cpx01110  Biosynthesis of secondary metabolites
cpx01120  Microbial metabolism in diverse environments
cpx01130  Biosynthesis of antibiotics
cpx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CpI19_1441 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    CpI19_1441 (aceF)
Enzymes [BR:cpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CpI19_1441 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADO26704
Position
complement(899645..900940)
Genome map
AA seq 431 aa AA seqDB search
MPELGESVTEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGVLLEVRFNEDDT
VDVGDVIAIIGEEGEAPAASDSDEKKEEPKQEAPKAEPTKEAPKEEPAKEAAKPVDNQNV
PYVTPLVRKLANKYGVDLNKVEGTGVGGRIRKQDVLAAAGQGSEPAQKEAPAAVKDPRAN
WSTKSVNPAKAELIGTTQKVNRIREITAKKMVEALQISAQLTHLQEVDMTNVATLRKDNK
PAFIEKYGVNLTYLPFFVKAVVEALVLHPNVNASYNAATKEITYHSDVNIAIAVDTERGL
LTPVIHKAQELTLPEIAQAIVDLADRARNNKLKPNDLSGATFTVTNIGSEGALADTPILV
PPQVGILGTAAIQKRPVVITENGSDAIAIRQMCYIPFSYDHQIVDGADAGRFTATIKDRL
EKAKFQDDLNL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactcggcgaatccgtcactgagggaacaattacccagtggctcaagtctgtc
ggcgacaccgtcgacgtcgacgagccgttgctcgaggtttccactgacaaggttgacacc
gaggttccttcccccgttgcgggcgttctgttggaggttcgcttcaacgaagacgacacc
gttgatgtcggcgatgttatcgccatcatcggtgaggaaggtgaggctcctgccgcaagc
gattctgatgagaagaaggaagagccgaagcaggaagcacccaaggcagaacccaccaag
gaagcacctaaggaagaaccggctaaagaggctgcaaagccagtcgataaccaaaacgtt
ccttatgtgaccccattggtacgcaagcttgctaataagtacggcgttgacctcaataag
gtcgaaggtaccggcgttggcggccgtatccgtaagcaagacgttctcgccgcagccggg
caaggatctgagccggctcaaaaagaagcccctgctgctgttaaggatcctcgcgctaac
tggtccaccaagagcgttaatcctgcaaaggcagagcttattggtaccacccagaaggtc
aaccgcatccgcgagatcacggctaagaagatggtcgaggcattgcagatttctgcacag
ctcacgcatcttcaagaggtggatatgaccaacgttgccacgctgcgcaaggacaacaag
ccggcattcatcgaaaagtatggcgttaacctgacctacctgccgttctttgttaaggcc
gtagttgaggctctagtcctgcacccgaacgtgaatgcgtcttacaacgctgccaccaag
gagatcacttaccactccgacgtcaatattgcgattgcagtggataccgagcgcggtctg
ctcacccctgtgatccacaaggcccaggagcttacgttgccggagatcgctcaggctatt
gttgatctggccgatcgcgcccgtaacaataagctgaagccaaacgacctatccggcgca
accttcactgtgaccaatatcggttccgagggtgccttggcagataccccaatcttggtt
ccaccgcaggttggtatcttgggcaccgctgcgatccagaagcgcccagtggtaatcact
gagaatggctcggacgccatcgcaatccgtcaaatgtgctacatcccgttctcttatgat
caccagatcgtagacggcgctgatgccggtcgcttcaccgcgacgatcaaggatcgcctg
gaaaaggctaagttccaggacgacctcaacctctaa

DBGET integrated database retrieval system