KEGG   Corynebacterium pseudotuberculosis I19: CpI19_1441Help
Entry
CpI19_1441        CDS       T01878                                 

Gene name
aceF
Definition
Dihydrolipoamide acyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpx  Corynebacterium pseudotuberculosis I19
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CpI19_1441 (aceF)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CpI19_1441 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    CpI19_1441 (aceF)
Enzymes [BR:cpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CpI19_1441 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1577641..1579632
Genome map
AA seq 663 aa AA seqDB search
MAHSVEMPELGESVTEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGVLLEVR
FNEDDTVDVGDVIAIIGEEGEAPAASDSDEKKEEPKQEAPKAEPTKEAPKGSGSSTDVVM
PELGESVTEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGVLLEVRFNEDDTV
DVGDVIAIIGEEGEAPAASDSDEKKEEPKQEAPKAEPTKEAPKGSGSSTDVVMPELGESV
TEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGVLLEVRFNEDDTVDVGDVIA
IIGEEGEAPAASDSDEKKEEPKQEAPKAEPTKEAPKEEPAKEAAKPVDNQNVPYVTPLVR
KLANKYGVDLNKVEGTGVGGRIRKQDVLAAAGQGSEPAQKEAPAAVKDPRANWSTKSVNP
AKAELIGTTQKVNRIREITAKKMVEALQISAQLTHLQEVDMTNVATLRKDNKPAFIEKYG
VNLTYLPFFVKAVVEALVLHPNVNASYNAATKEITYHSDVNIAIAVDTERGLLTPVIHKA
QELTLPEIAQAIVDLADRARNNKLKPNDLSGATFTVTNIGSEGALADTPILVPPQVGILG
TAAIQKRPVVITENGSDAIAIRQMCYIPFSYDHQIVDGADAGRFTATIKDRLEKAKFQDD
LNL
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgaaatgcctgaactcggcgaatccgtcactgagggaacaattacc
cagtggctcaagtctgtcggcgacaccgtcgacgtcgacgagccgttgctcgaggtttcc
actgacaaggttgacaccgaggttccttcccccgttgcgggcgttctgttggaggttcgc
ttcaacgaagacgacaccgttgatgtcggcgatgttatcgccatcatcggtgaggaaggt
gaggctcctgccgcaagcgattctgatgagaagaaggaagagccgaagcaggaagcaccc
aaggcagaacccaccaaggaagcacctaagggctccgggtcctccaccgacgtggtcatg
cctgagctgggcgaatccgtcactgagggaacaattacccagtggctcaagtctgtcggc
gacaccgtcgacgtcgacgagccgttgctcgaggtttccactgacaaggttgacaccgag
gttccttcccccgttgcgggcgttctgttggaggttcgcttcaacgaagacgacaccgtt
gatgtcggcgatgttatcgccatcatcggtgaggaaggtgaggctcctgccgcaagcgat
tctgatgagaagaaggaagagccgaagcaggaagcacccaaggcagaacccaccaaggaa
gcacctaagggctccgggtcctccaccgacgtggtcatgcctgaactcggcgaatccgtc
actgagggaacaattacccagtggctcaagtctgtcggcgacaccgtcgacgtcgacgag
ccgttgctcgaggtttccactgacaaggttgacaccgaggttccttcccccgttgcgggc
gttctgttggaggttcgcttcaacgaagacgacaccgttgatgtcggcgatgttatcgcc
atcatcggtgaggaaggtgaggctcctgccgcaagcgattctgatgagaagaaggaagag
ccgaagcaggaagcacccaaggcagaacccaccaaggaagcacctaaggaagaaccggct
aaagaggctgcaaagccagtcgataaccaaaacgttccttatgtgaccccattggtacgc
aagcttgctaataagtacggcgttgacctcaataaggtcgaaggtaccggcgttggcggc
cgtatccgtaagcaagacgttctcgccgcagccgggcaaggatctgagccggctcaaaaa
gaagcccctgctgctgttaaggatcctcgcgctaactggtccaccaagagcgttaatcct
gcaaaggcagagcttattggtaccacccagaaggtcaaccgcatccgcgagatcacggct
aagaagatggtcgaggcattgcagatttctgcacagctcacgcatcttcaagaggtggat
atgaccaacgttgccacgctgcgcaaggacaacaagccggcattcatcgaaaagtatggc
gttaacctgacctacctgccgttctttgttaaggccgtagttgaggctctagtcctgcac
ccgaacgtgaatgcgtcttacaacgctgccaccaaggagatcacttaccactccgacgtc
aatattgcgattgcagtggataccgagcgcggtctgctcacccctgtgatccacaaggcc
caggagcttacgttgccggagatcgctcaggctattgttgatctggccgatcgcgcccgt
aacaataagctgaagccaaacgacctatccggcgcaaccttcactgtgaccaatatcggt
tccgagggtgccttggcagataccccaatcttggttccaccgcaggttggtatcttgggc
accgctgcgatccagaagcgcccagtggtaatcactgagaatggctcggacgccatcgca
atccgtcaaatgtgctacatcccgttctcttatgatcaccagatcgtagacggcgctgat
gccggtcgcttcaccgcgacgatcaaggatcgcctggaaaaggctaagttccaggacgac
ctcaacctctaa

DBGET integrated database retrieval system