KEGG   Corynebacterium pseudotuberculosis I19: CpI19_1484Help
Entry
CpI19_1484        CDS       T01878                                 

Gene name
thrC
Definition
(RefSeq) Threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cpx  Corynebacterium pseudotuberculosis I19
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cpx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CpI19_1484 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CpI19_1484 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CpI19_1484 (thrC)
Enzymes [BR:cpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CpI19_1484 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1620407..1621849)
Genome map
AA seq 480 aa AA seqDB search
MHYISTRDTSQTPVAFTDILLGGLAPDGGLYLPEYYPRLDAATLDTWRGILAQQGYAALA
AEVLKLFVDDIPAEDLEAITARAYTTPKFSDEEIVPVTKLEDGIYIGHLSEGPTAAFKDM
AMQLLGELFEYELLRRKETLNILGATSGDTGSSAEYAMRGRAGIRVFMLTPKDRMTPFQQ
AQMFGLDDPNIFNIALEGVFDDCQDVVKAVSSDAEFKADNHIGAVNSINWARLMAQVVYY
ISLWLKVTEKSNQKVSFCVPTGNFGDICAGHIAKQMGLPIDRLIVATNENDVLDEFFRTG
EYRVRSAAETLETSSPSMDISRASNFERFIFDLLGRDSERCAELFGEQVKAGGFSLAEDD
SFEQAATHYGFASGSSTHADRIATIADCYTRRGLMLDPHTADGVKVAREWATQIESPIVC
LETALPVKFTDTIVEAVGRGPEIPERFTGILEAQRHVTDLPNDVVAVKNFILESIARDSA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgcactacatttcgacaagagacacttcccagacccctgtagcgtttactgacatcctc
ttgggaggtctcgctccagatggtggtttgtatcttcctgagtattacccgcgtctcgac
gctgccaccctagacacctggcgcggcattcttgcccagcaaggctatgcggcgctagca
gcagaagtgcttaagctctttgtcgacgacatcccggctgaggatctagaagctattact
gcgcgcgcttatacaacgcctaagttttccgatgaggaaatcgttccggtgaccaagctt
gaggatggcatctatataggtcacctctctgaggggcccactgctgcatttaaagatatg
gccatgcagctccttggcgagctctttgagtatgagttgctacgacgcaaggaaacttta
aacatcctgggtgctacctctggcgacacaggttcttctgcggaatacgctatgcgcgga
cgcgccggtatccgagtgttcatgcttacccctaaagatcgtatgacgccgtttcagcag
gcccagatgtttggtctagacgatccgaatatcttcaatattgccttagagggtgttttt
gatgactgccaagacgtggtcaaagcggtatcttcagacgcagaatttaaagcagacaac
catatcggcgcggtgaactcaattaactgggctcgcttgatggctcaagtggtgtactac
atttctttgtggctcaaagtaactgagaaaagcaatcaaaaagttagtttctgtgttccc
accggcaattttggtgatatctgcgcagggcatatagctaaacaaatgggattgcccatt
gacaggctcatcgttgctaccaatgaaaacgatgtcctggatgagtttttcagaactggt
gaatatcgtgtgcgttctgcggctgagacccttgagacctcctcgccctcgatggatatt
tctcgggcatccaactttgagcgttttatttttgacctattaggaagagactccgagcgc
tgcgcagaactattcggggagcaagtaaaggccggcggtttctctctcgcagaggacgat
tcatttgaacaagctgccacccattatggttttgcgtcgggcagctctactcacgcagac
cgcatagccaccattgccgattgttatacgcgccggggcctgatgttggaccctcatacc
gctgatggtgtgaaagttgcgcgcgagtgggccactcagattgaaagccctattgtctgc
ttggaaaccgccctgccagttaaatttacggatactatcgttgaggccgtggggcgtggt
cctgagataccagagcgttttactgggattctcgaggcacaacgccatgtcaccgatctg
cctaatgacgttgttgcggtgaagaactttattctggaaagcattgctcgggactctgcg
taa

DBGET integrated database retrieval system