KEGG   Corynebacterium pseudotuberculosis I19: CpI19_1903Help
Entry
CpI19_1903        CDS       T01878                                 

Gene name
adhA
Definition
Alcohol dehydrogenase GroES-like protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cpx  Corynebacterium pseudotuberculosis I19
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cpx00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CpI19_1903 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpI19_1903 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    CpI19_1903 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CpI19_1903 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CpI19_1903 (adhA)
   00626 Naphthalene degradation
    CpI19_1903 (adhA)
Enzymes [BR:cpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CpI19_1903 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2073730..2074887)
Genome map
AA seq 385 aa AA seqDB search
MVVSPAGVMPVGVQSFRGLNEYRSQQGVGIDNAYEKGKIDVKTDFPEAFTAAVVDNFGPE
LNIHDVVLPEPGPNQALVKLVASGICHTDLHAAEGDWPVKPEPPFVPGHEGVGEVVKLGP
GHHRVQLGDMVGNVWLWSACGECEYCRTGRETLCNDAEYGGYTVDGSFGEYMLVDTRYCA
RIPEGSDPVEVAPILCAGVTVYKGLKETECKPGQYMVISGIGGLGHIAVQYAVAMGMRVI
AVDIADEKLELARKHGAEFAVNALKEDPVESINAFTSGGAHGVLVTAVHPQAFGQAIGMA
RKGGTIVFNGLPPGEFPAPIFEIVFKGLTIRGSLVGTRQDLEEALDFYARGMIKPTVTEC
KLGDVNSVFADMHKGTVDGRMAIRY
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggttgtgtccccagccggcgtcatgccggttggggttcagtcgtttaggggacttaat
gaataccgttcccaacaaggtgtaggtattgacaatgcctacgagaaaggaaagatcgac
gtgaaaaccgatttccctgaggccttcaccgccgctgtagttgacaactttggccctgaa
ctcaatatccacgatgttgttttgcccgagccgggacctaatcaggcattggtaaagctg
gtggcctctggtatttgccatacagatcttcatgcggcggaaggggactggccggtaaaa
ccggaaccgccttttgtccccgggcatgaaggcgtgggggaagttgtgaaattgggaccc
ggccatcatcgcgtgcaacttggagacatggtgggcaacgtttggctttggtccgcctgt
ggggagtgcgagtactgccgcaccggacgtgaaaccctttgcaatgacgccgaatatggc
ggctatacggtcgacggctcttttggtgaatacatgctggtagatacccgctactgtgcg
cgtattccagaaggctccgatccagttgaagtggcccccatcttgtgtgccggcgtgacc
gtgtacaaaggcctcaaagaaaccgagtgtaagccgggccagtacatggtgatttccggc
atcggtggcctagggcatatcgctgtgcagtatgcggtggctatgggaatgcgagtgatc
gctgtggatattgcagatgagaagctcgagctggcgcgtaagcacggtgcagaatttgca
gtcaatgcgttgaaggaagacccggttgagtcgatcaacgcatttacctcaggtggtgcg
catggcgttttggtcactgccgtgcacccgcaggcgtttggacaagccatcgggatggcc
agaaaaggcggaaccatcgtatttaatgggcttcctccaggagagttcccggcaccgatt
tttgagattgtgttcaaggggttaactattcgcggttcattggtgggaacgcgccaggac
ctagaagaagccctggatttctatgcacgcggaatgatcaaaccgaccgttacggaatgc
aagcttggcgacgtcaacagtgtcttcgccgatatgcataaaggcacggttgatggtcgc
atggctattaggtattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system