KEGG   Corynebacterium pseudotuberculosis I19: CpI19_2005Help
Entry
CpI19_2005        CDS       T01878                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cpx  Corynebacterium pseudotuberculosis I19
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpx00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CpI19_2005 (deoA)
Enzymes [BR:cpx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     CpI19_2005 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2203137..2204474
Genome map
AA seq 445 aa AA seqDB search
MPYSTSQALTAPMEGDTVAEKFDAVDVIRTKRDNGKLSKGQIDWIIDAYTRGIVGDDQMA
ALNMAIFLNGMDREEIVQWTQAMIDSGETMSFASLSRPTTDKHSTGGVGDKITLPLAPLV
ASYGVAVPQLSGRGLGHTGGTLDKLEAIPGWEADIDNARMMKILEDPGCVVCAAGAGLAP
ADKKIYALRDITATVDCIPLIASSIMSKKIAEGTANLVLDVKVGSGAFMKELDQARELAR
TMVDLGRDARTNMVALLTDMSVPLGRTIGNALEVRESVEVLAGGGPSDVIELTCALATEM
LELAGVHDPDVHEALADGRAMDSWKKMIRAQGGDPDAALPTARHTHEVTADRDGYLTEMD
ALALGVASWRLGAGRARKEDPVQLGAGIEIHAELGEKVSKGQKLFTLHTDDEDRFSRALE
SLEPGVNIGDEPPAPRPSVILDRIS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
ttgccatatagcacttcccaagccttaacagctccaatggaaggtgataccgtggccgag
aaattcgacgccgtagacgtcatccgcacaaagcgggacaacgggaagctaagcaaggga
caaatcgactggatcatcgatgcctacactcgcggcattgttggcgacgatcaaatggct
gccctcaacatggcaatattcctcaacggcatggacagagaagaaatcgtccagtggacc
caggccatgatcgactccggcgagaccatgagctttgccagcctctcccggccaacaaca
gacaagcactccaccggcggggtcggcgataaaatcacgcttccacttgcgccactcgtt
gccagttacggcgttgctgtgccacaactctctggtagaggactaggacacacaggcgga
accctagacaaattagaggccatccccgggtgggaagctgacatagataatgcccgaatg
atgaagatcctcgaagaccccggctgcgtggtatgcgccgcgggagcaggcctcgcaccc
gccgacaagaagatctatgcgctgcgtgacatcactgccaccgtcgactgcatcccactg
atcgccagctccatcatgagtaaaaaaatcgccgagggaaccgcaaacctagtcctcgac
gtcaaggtgggttccggggcctttatgaaggagcttgaccaggcccgcgagctcgcccgc
acaatggttgacctaggccgcgacgccagaaccaatatggtcgcgcttctcaccgacatg
tccgtccccctggggcgcaccatcggcaatgccctagaagttcgcgagtctgtagaggtc
ctcgcaggtggcggcccttccgacgtcatagagctcacatgcgcccttgcgacggagatg
cttgagctcgccggcgtccatgatcccgatgtccacgaagcgcttgccgacggccgcgcg
atggactcttggaagaagatgatccgcgcacagggcggcgaccccgacgcagcactcccc
accgcacggcacacccatgaggtcaccgccgatcgcgacggctatctcacagagatggac
gccctcgcactgggagtagccagctggcgactcggcgcaggacgcgcacgcaaggaagat
ccagtccaactcggcgcaggcatcgagatccatgcagagctcggcgagaaggtatcaaag
ggccagaagcttttcaccctccacaccgacgatgaggaccgtttcagccgagccctagaa
tccctcgaacccggcgtaaatatcggcgatgagcccccggcacctcgcccctcggtcatc
cttgatcgcatcagctaa

DBGET integrated database retrieval system