KEGG   Lachnoclostridium phytofermentans: Cphy_0041Help
Entry
Cphy_0041         CDS       T00619                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cphy_0041
Enzymes [BR:cpy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Cphy_0041
Exosome [BR:cpy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cphy_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
58361..59860
Genome map
AA seq 499 aa AA seqDB search
MEKYIMALDQGTTSSRCILFNQRGEVCSVAQKEFTQVYPRTGWVEHRPMDIWSSQISVAA
EAMAAIGAKAEDIDSIGITNQRETTIVWDKNTGEPVYNAIVWQCHRTADMIEQLKKDGFD
SVIRKKTGLIPDAYFSATKIKWILDNVDGVRERAEAGSLLFGTVDTWIIWNLTKGRVHVT
DYTNASRTMLFDIHNLCWDDEILTYFKIPKSMLPKVQASSSIFGHTEEGLLGGEILISGA
AGDQQAALFGQCCFEPGEVKNTYGTGCFLLMNTGDTAIESQNGLLTTIAAGDAGHIEYAL
EGSVFVAGAAIQWLRDEQRMIKKASQSEEYAKEVEDTNGVYVVPAFTGLGAPYWNPYARG
TIVGITRGFSKEHMIRATLESLAYQTVNVLHAMEQDSNISLKSLRVDGGASANNFLMQFQ
ADVLNTLVYRPQCIETTALGAAYLAGLATGYFKDRNEIKDNWTLGGTFSPQMDEQKRKEL
LKGWKRAVRCALAWAEDIE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtacattatggcacttgatcaggggacaacaagttcgcgatgtattcttttt
aaccagagaggggaagtttgcagtgtagcgcagaaggaattcacgcaggtgtacccaaga
actggctgggtggaacatagaccgatggatatctggtcttctcagataagtgtggcagca
gaggcgatggcagcaattggtgcgaaagcagaagatattgattcgattggaattacaaat
caaagagagaccactattgtttgggataagaatacaggagaacctgtatataatgctatt
gtgtggcaatgccatcgtaccgcagatatgattgagcaattaaaaaaagatgggtttgat
tccgtaataagaaaaaagacgggacttatcccagatgcctatttttctgcaactaagata
aagtggattcttgataatgtagatggggttagggaaagagcagaagcaggaagtctttta
tttggaacggttgatacctggattatatggaacttgacaaaaggtagagtacatgtaacg
gattataccaatgcttcacgtacgatgctttttgacattcataacctttgttgggatgat
gaaatcttaacttattttaaaataccaaagagtatgctacctaaggtgcaggcatctagt
agtatctttggacataccgaagaaggtcttcttggtggtgaaattcttatttctggtgct
gccggtgatcaacaagcggcattattcggacagtgctgttttgagccgggtgaagttaag
aatacgtatggtactggatgttttcttttgatgaatactggagatactgcaattgaatca
caaaatggattacttacaacaatagctgcaggagatgcggggcatattgagtatgcatta
gaaggaagcgtttttgttgctggtgcagccattcaatggttaagagatgagcagagaatg
attaaaaaggccagccagtcagaagagtatgcaaaagaggtagaggatacaaatggtgtt
tatgtagtaccagcatttaccggtcttggcgccccttactggaatccatatgctagaggg
acaatcgttggtattactagagggtttagtaaggagcatatgattcgagcaaccttagaa
tcacttgcataccaaactgtgaatgttcttcatgcaatggaacaagactctaatatatcc
ttaaagagtcttagggtagatggcggtgctagtgcaaataatttcttaatgcagtttcaa
gcagatgtcctaaacacattggtatatcgtccacaatgtattgaaacaacggcgctgggt
gctgcttatcttgcaggacttgcaactggatattttaaggaccgaaatgaaattaaagat
aattggacacttggcggtactttctccccacagatggatgaacaaaaacgaaaggaactt
ttaaagggctggaaacgtgctgttcgatgtgcgcttgcatgggcggaggatatcgagtaa

DBGET integrated database retrieval system