KEGG   Clostridium phytofermentans: Cphy_0041Help
Entry
Cphy_0041         CDS       T00619                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cpy  Clostridium phytofermentans
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cpy00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
58361..59860
Genome map
AA seq 499 aa AA seqDB search
MEKYIMALDQGTTSSRCILFNQRGEVCSVAQKEFTQVYPRTGWVEHRPMDIWSSQISVAA
EAMAAIGAKAEDIDSIGITNQRETTIVWDKNTGEPVYNAIVWQCHRTADMIEQLKKDGFD
SVIRKKTGLIPDAYFSATKIKWILDNVDGVRERAEAGSLLFGTVDTWIIWNLTKGRVHVT
DYTNASRTMLFDIHNLCWDDEILTYFKIPKSMLPKVQASSSIFGHTEEGLLGGEILISGA
AGDQQAALFGQCCFEPGEVKNTYGTGCFLLMNTGDTAIESQNGLLTTIAAGDAGHIEYAL
EGSVFVAGAAIQWLRDEQRMIKKASQSEEYAKEVEDTNGVYVVPAFTGLGAPYWNPYARG
TIVGITRGFSKEHMIRATLESLAYQTVNVLHAMEQDSNISLKSLRVDGGASANNFLMQFQ
ADVLNTLVYRPQCIETTALGAAYLAGLATGYFKDRNEIKDNWTLGGTFSPQMDEQKRKEL
LKGWKRAVRCALAWAEDIE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtacattatggcacttgatcaggggacaacaagttcgcgatgtattcttttt
aaccagagaggggaagtttgcagtgtagcgcagaaggaattcacgcaggtgtacccaaga
actggctgggtggaacatagaccgatggatatctggtcttctcagataagtgtggcagca
gaggcgatggcagcaattggtgcgaaagcagaagatattgattcgattggaattacaaat
caaagagagaccactattgtttgggataagaatacaggagaacctgtatataatgctatt
gtgtggcaatgccatcgtaccgcagatatgattgagcaattaaaaaaagatgggtttgat
tccgtaataagaaaaaagacgggacttatcccagatgcctatttttctgcaactaagata
aagtggattcttgataatgtagatggggttagggaaagagcagaagcaggaagtctttta
tttggaacggttgatacctggattatatggaacttgacaaaaggtagagtacatgtaacg
gattataccaatgcttcacgtacgatgctttttgacattcataacctttgttgggatgat
gaaatcttaacttattttaaaataccaaagagtatgctacctaaggtgcaggcatctagt
agtatctttggacataccgaagaaggtcttcttggtggtgaaattcttatttctggtgct
gccggtgatcaacaagcggcattattcggacagtgctgttttgagccgggtgaagttaag
aatacgtatggtactggatgttttcttttgatgaatactggagatactgcaattgaatca
caaaatggattacttacaacaatagctgcaggagatgcggggcatattgagtatgcatta
gaaggaagcgtttttgttgctggtgcagccattcaatggttaagagatgagcagagaatg
attaaaaaggccagccagtcagaagagtatgcaaaagaggtagaggatacaaatggtgtt
tatgtagtaccagcatttaccggtcttggcgccccttactggaatccatatgctagaggg
acaatcgttggtattactagagggtttagtaaggagcatatgattcgagcaaccttagaa
tcacttgcataccaaactgtgaatgttcttcatgcaatggaacaagactctaatatatcc
ttaaagagtcttagggtagatggcggtgctagtgcaaataatttcttaatgcagtttcaa
gcagatgtcctaaacacattggtatatcgtccacaatgtattgaaacaacggcgctgggt
gctgcttatcttgcaggacttgcaactggatattttaaggaccgaaatgaaattaaagat
aattggacacttggcggtactttctccccacagatggatgaacaaaaacgaaaggaactt
ttaaagggctggaaacgtgctgttcgatgtgcgcttgcatgggcggaggatatcgagtaa

DBGET integrated database retrieval system