KEGG   Clostridium phytofermentans: Cphy_0048Help
Entry
Cphy_0048         CDS       T00619                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cpy  Clostridium phytofermentans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cpy03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
66208..66804
Genome map
AA seq 198 aa AA seqDB search
MDYYSTQISKLIEELGRLPGIGAKSAQRLAFHIINMPKEQVEHLAKTMLDARSNVKYCKV
CQTLTDKEICPICSSEKRDQKVIMVVENTRDLAAYEKTGKFDGVYHVLHGAISPMLGIGP
QDIKLKELMLRLQGDVDEVIIATNSSLEGEATAMYISKLIKPAGIKVSRIASGVPVGGDL
EYIDEVTLLRALDGRIQL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtggattattatagtacacagattagtaagttgattgaagagcttggtaggttacctggc
attggtgcgaaatccgcacaaagacttgcatttcatattattaatatgccaaaggaacag
gtagaacatcttgcaaaaacgatgcttgatgcaagaagcaacgttaaatattgtaaagtg
tgccagaccttaacagacaaagagatttgccctatttgctctagtgagaagagagatcaa
aaggtcataatggtggtggaaaatacgagagacttagcagcttatgaaaagaccggcaaa
tttgatggggtctaccatgtattacatggagctatttctcctatgctcggaatcgggcca
caggatattaaattaaaggaattaatgttacgtcttcaaggggatgtagatgaagtaata
atagcgacgaactcgagtcttgagggtgaggccactgcgatgtatattagtaaattaatt
aagcctgctggcattaaagtaagccgtatcgcaagcggtgtaccagtaggcggtgacctt
gaatacattgatgaagtaacattacttcgtgcgctagacggaagaattcagttatag

DBGET integrated database retrieval system