KEGG   Clostridium phytofermentans: Cphy_0104Help
Entry
Cphy_0104         CDS       T00619                                 

Definition
phosphoribosylpyrophosphate synthetase (EC:2.7.6.1)
Orthology
K00948  
ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
cpy  Clostridium phytofermentans
Pathway
Pentose phosphate pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
PRPP biosynthesis, ribose 5P => PRPP
Class
Metabolism; Overview; Carbon metabolism [PATH:cpy01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cpy01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cpy00030]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cpy00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(139859..141028)
Genome map
AA seq 389 aa AA seqDB search
MSQDNFKETLPVGTLGIIALESSQALGQKVNDYIVEWRKKRTGEHTTTMQFAGYQRDSYL
IKHQCPRFGSGEAKGLIKESVRGDDLYLLVDVCNYSLTYSLCGHTNHMSPDDHYQDLKRI
IAAVGGKARRITVIMPFLYESRQHKRSSRESLDCALALQELTNMGVESIITFDAHDPRVQ
NAIPLKSFETVMPSYQFIKNLLKNVPDLVVDAKHMMVISPDEGAMGRAVYFANVLGLDMG
MFYKRRDYTTIVNGRNPIVAHEFLGADVEGKDVLILDDMISSGESMLDVAKELKKRKAKR
IFVCATFGLFTNGLDKFDEAYEQGLIDFVMTTNLVYQTEELLSRPYYINADMSKYVALLI
DALNHDASISEFLSPTERIQSVLNKYNNK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagataattttaaagaaaccctacctgtaggaactcttggtatcattgccttg
gaaagcagccaggctcttggtcagaaagtaaatgattatattgttgaatggagaaaaaaa
cgcaccggtgagcatacaacaacaatgcaatttgctggttatcaaagagactcctactta
attaagcatcaatgtccacgttttggttccggtgaagcaaaaggtcttattaaagaatcc
gttcgtggagatgacttatacttacttgttgacgtttgtaattatagcttaacttattcc
ttatgtggtcataccaatcatatgtccccagatgaccactatcaagatttaaagagaatt
attgctgctgttggtggtaaggcaagaagaattactgttattatgcctttcttatatgaa
agcagacaacataagagaagttctcgtgagtctttagactgtgcattagcacttcaagaa
cttacaaacatgggtgtagaaagtattattacttttgatgcacatgatcctcgtgttcaa
aatgcgattccactaaagagttttgaaactgtaatgccatcctatcagtttatcaagaat
ttattaaagaatgttcctgatttagtagtagatgctaagcatatgatggtaatcagccct
gatgaaggtgctatgggacgtgctgtttactttgcaaacgttcttggacttgatatgggt
atgttctacaaacgccgtgactatacaactattgtaaatggacgtaatccaatcgttgct
catgagttcttaggagcagacgtagaaggtaaagatgtactgatcttagacgatatgatt
tcctcaggcgaaagtatgttggatgtagcaaaagaattaaagaagagaaaagcaaaacgt
atctttgtatgcgctacttttggtttattcacaaatggccttgataaatttgatgaagct
tacgaacaaggactgattgatttcgtaatgactacaaaccttgtttatcagacagaggaa
ttacttagcagaccttactatatcaatgcagatatgagtaagtatgttgcattattaatt
gatgcattgaatcatgatgcttccattagcgaattcttaagcccaacagaacgtattcaa
agtgttcttaataagtataataataaataa

DBGET integrated database retrieval system