KEGG   Lachnoclostridium phytofermentans: Cphy_0206Help
Entry
Cphy_0206         CDS       T00619                                 

Definition
arsenate reductase
Orthology
K00537  
arsenate reductase [EC:1.20.4.1]
Organism
cpy  Lachnoclostridium phytofermentans
Brite
Enzymes [BR:cpy01000]
 1. Oxidoreductases
  1.20  Acting on phosphorus or arsenic in donors
   1.20.4  With disulfide as acceptor
    1.20.4.1  arsenate reductase (glutaredoxin)
     Cphy_0206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
255647..256024
Genome map
AA seq 125 aa AA seqDB search
MSYQYLEYPKCTTCIKARKWLEKNQIAFESRDITVNNPTKEELKLWHEKSGLTLTKFFNT
SGLLYREQNLKEKVKVMTVEEMIEILSTNGMLVKRPILVGDDFILVGFKEDEWKKRLLPP
VLKRY
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgagttatcagtatttagagtatccgaaatgtacaacatgtataaaagcaagaaaatgg
ttagaaaaaaatcagattgcttttgaatcaagagatattacagtaaataatcctacgaag
gaagaactaaaactttggcatgagaaaagtggattgacacttactaaattttttaatacc
agtggacttctttatcgagaacaaaacctaaaagaaaaggttaaagtaatgacagttgag
gaaatgattgaaatattatctaccaacggcatgttagtaaaacgaccaattttagttggc
gatgactttatacttgttggatttaaagaagatgaatggaagaagagattgcttccacca
gttttgaaaaggtattag

DBGET integrated database retrieval system