KEGG   Lachnoclostridium phytofermentans: Cphy_0246Help
Entry
Cphy_0246         CDS       T00619                                 

Definition
recombinase D (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cphy_0246
Enzymes [BR:cpy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cphy_0246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
304326..306554
Genome map
AA seq 742 aa AA seqDB search
MAEELKGYVERIVYRNAENGYTVLSLSAEEDEVTCVGTFSFVNEGEYLSLTGSYTAHPLY
GEQFQVSSYEMKEPEDLLSIERYLGSGAIKGVGTALAARIVRKFKEKTFVIIEEEPERLS
EVKGISDKLAREIYRQFSEKREMRSAMLFLQQYGISLNLAVKIYKQYGERMYEVIKENPY
RLAEDISGVGFKIADEIASRIGIRTDSDYRVKAGILYNLLLASGNGHVYLPMHSLVGKTC
EMLMVEADTVKRHITSLALEKKLVVKESGEEQHVYSTSFYYMELNVANMLSDLSISYDIS
PAQVETRLAKIEQETNLELDEMQRYAVMEAVRSGLLIITGGPGTGKTTTINTILRFFEAE
GMDMLLAAPTGRAAKRMKETTGYEASTIHRLLELTKGMDDKDGRMSFERNELNPLEADVI
IIDEMSMVDISLMHSLLKAITVGTRIILVGDVNQLPSVGPGNVLRDMIESKAFPVVMLKK
IFRQASESDIIVNAHKINSGEHITLDNKSKDFFLLKRDDVNVIISVIISLVRDKMPKYVN
ASVYDIQVLTPMRKGELGVERLNQVLQQYLNPSSQEKKEKEHFGGIFREGDKVMQVKNNY
QIAWETKSRYGITIDSGTGVFNGDTGVIKEINLFAEELTVEFDEGRLVTYPFSQLEELEL
AYAVTIHKSQGSEYPAVVLPIYSGPRMLFNRNLLYTAVTRAKQCVTIVGSDNMVQSMIDN
ESELKRYSGLQSRIMERKQILS
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagagttaaaaggatatgtagagagaattgtatatcgaaatgctgaaaatggt
tatactgtactaagtctctccgcagaggaagatgaagtgacctgcgttggcacattttct
tttgtgaatgaaggagaatatctttctttaaccggtagctatactgcacatccattgtat
ggtgagcaatttcaggtgagctcctatgagatgaaggagccagaggacttactatcgatc
gaacgttacttagggtccggtgcaatcaaaggagtaggaaccgcattagccgcacgtatt
gttcgtaaatttaaagaaaaaacatttgtgattattgaagaagaaccggaacgtctttct
gaagtgaaggggatcagtgataagttagcaagagagatttacaggcagttttccgaaaag
agagagatgagaagtgctatgctatttcttcaacaatatggcatctccttaaatcttgca
gtaaaaatctataagcagtatggagagcgtatgtatgaggttataaaagagaatccatat
cgcttggcagaagatattagtggagtaggttttaagattgcagatgaaatcgcctctagg
ataggaattcgaactgactcagactatcgcgtaaaagcaggtatcctttataacttattg
cttgcaagcggtaacggacatgtatatcttccaatgcatagtttggtaggtaaaacctgt
gagatgcttatggtggaagcagatacggttaagaggcacattacctctctcgctcttgaa
aaaaagctggtagtaaaagaatcaggggaagaacagcatgtttatagtacatctttttac
tatatggagttaaatgttgcgaatatgctttctgatcttagtatatcctatgatatctcc
ccagctcaagttgaaacgagacttgcaaaaattgaacaggaaacaaatctggagctagat
gaaatgcaacgctatgctgtgatggaggctgtccgcagcgggttattaattataaccggt
ggtcctggtactggtaaaactacaaccattaatacaatacttcgcttttttgaagcagaa
gggatggatatgcttctagcagcgcctactggacgagctgcaaagcgtatgaaagaaacg
actggttatgaagcaagtacgatccatcgtttattggagcttacgaagggaatggacgat
aaggatggtaggatgagctttgaacgtaacgagctaaatcctcttgaggcggatgtgatt
atcatcgatgagatgtcgatggttgacatctcgttaatgcattctttattaaaagcgatt
acggttggcaccagaataatcttagttggtgacgttaaccagttacctagcgttggaccg
ggtaatgtactgcgagatatgattgaatcgaaggcatttccagttgttatgctaaaaaag
atttttaggcaggcatccgaaagtgatattatcgtaaatgctcataagatcaattccgga
gaacatattaccttggataataagagtaaggatttctttttgctaaaaagagatgatgtt
aatgtaattattagcgtaattatctctctagttcgcgataagatgcccaagtacgtgaat
gcttctgtttacgatattcaagtacttacgccgatgcgaaaaggagaacttggtgtagaa
agattgaatcaagtattacaacagtatctaaacccttcctcccaggagaaaaaggaaaag
gaacatttcggtggaatctttcgtgagggtgataaggttatgcaggtgaagaacaattat
caaatcgcctgggagaccaaaagccgttatggtattacaattgatagtgggactggtgta
tttaacggcgatacaggagtaattaaagaaattaatctttttgcagaggagttaacggta
gagtttgatgaaggacgtctggttacctatccatttagtcaattagaggaattagaactg
gcttatgcagtgacgattcacaaatcacagggtagtgaatacccagcggttgttctacct
atatacagtgggccaaggatgttatttaaccgaaaccttttatatacagcggttacaaga
gcaaagcaatgcgttactatcgttggtagtgataatatggtgcagtcaatgattgataac
gaaagtgagttaaagcgttattcgggtttacagtctagaattatggaaaggaagcaaata
ttaagctag

DBGET integrated database retrieval system