KEGG   Lachnoclostridium phytofermentans: Cphy_0336Help
Entry
Cphy_0336         CDS       T00619                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cphy_0336
   01230 Biosynthesis of amino acids
    Cphy_0336
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cphy_0336
   00030 Pentose phosphate pathway
    Cphy_0336
   00051 Fructose and mannose metabolism
    Cphy_0336
   00052 Galactose metabolism
    Cphy_0336
  Energy metabolism
   00680 Methane metabolism
    Cphy_0336
Enzymes [BR:cpy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cphy_0336
Protein phosphatases and associated proteins [BR:cpy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cphy_0336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
422399..423424
Genome map
AA seq 341 aa AA seqDB search
MTSSKDVMFEQLGASNEITSNVKTIGILTSGGDAPGMNAAIRAVVRTALANGLEVKGIRR
GFTGLLEEDIIDLNANSVSDIIQRGGTILYTARCPEFVTKEGQDKGAEVCRKHGIDGLVV
IGGDGSFQGAKQLAARGINTVGLPGTIDLDIACTDYTIGFDTAVNTAMESIDKVRDTSTS
HERCSIIEVMGRNAGYIALWCGIANGAEDVLTTERYDHDEQRIISNIIEKRKIGKKHHII
VNAEGIGDSYGMAKRIEAATGMETRATIIGHIQRGGSPTCKDRVYASAMGAKAVDILCRG
GSNRVVAYKHGEFVDFDINEALAMKKDLDEYLFQMSKKLSR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacaagttcgaaggatgtaatgtttgagcagttgggtgcttcaaatgaaattactagt
aatgtaaagacaattggtatattaacaagtggtggagatgctcctggtatgaatgctgct
attcgtgcagtagtacgtacagcattagcgaatggtttagaggtaaagggaattcgcaga
ggattcacaggacttttagaagaagatattattgatctgaatgcaaatagtgtgtcagat
atcatccaacgtggtggtacaatattatatacagctcgttgtcctgagttcgttacgaaa
gagggtcaggataaaggcgccgaagtctgtagaaagcatggaattgatggattagtagtg
attggtggagatggttctttccaaggtgcaaagcaattagcagcaagaggaattaatact
gttggacttccaggaaccattgatcttgatatcgcatgtacagattatacaattggtttt
gatacagctgtaaatacagcaatggaatcaattgataaagttcgtgatacatcaacttcc
catgaacgttgcagcattattgaagttatgggtagaaatgctggatatatcgcattatgg
tgtggcatcgcaaatggtgcagaagatgttcttacaacagagcgttatgaccatgatgag
cagagaattattagtaacatcattgaaaagcgcaaaattggtaagaaacatcatatcatt
gtaaatgcagaaggaatcggcgattcctatggaatggcgaaaagaattgaagctgcaact
ggtatggaaactcgtgctactattattggacatattcaacgtggtggtagtccaacttgt
aaagatcgtgtttatgcatcagccatgggagcaaaagcagtagatatcctatgtagaggt
ggcagtaaccgagttgttgcttataaacatggtgaatttgtagactttgatatcaatgag
gctcttgcaatgaaaaaggatttggatgagtacttattccagatgtcaaagaaattatca
agataa

DBGET integrated database retrieval system