KEGG   Lachnoclostridium phytofermentans: Cphy_0556Help
Entry
Cphy_0556         CDS       T00619                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cphy_0556
   00052 Galactose metabolism
    Cphy_0556
Enzymes [BR:cpy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Cphy_0556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
715212..716273
Genome map
AA seq 353 aa AA seqDB search
MKISQRPFGKTKQGEKVTLYTITNDHGMVVSFSDFGANIVSIIVPDKNGTFADVALGYDN
VKQYEVNGPGYGSFIGRHANRIAEALVVINGKEYKLEKNDGNHNLHSGSKGYNKFLYETE
VFKDKDETTVEFSRLSPDMEQGLPGNLDLVVSYTLTNDNELAIEYYGVSDKDTIINFTNH
SYFNLAGHNSGSIEGHQVMIDSDEFTLTDETLIPTGEIAKVEGTPMDFRKLKKIGKDIEA
DYQPLRVAGGYDHNYVLKTSEEEAAKVAELWEEKSGRLMEVFTDAKGLQLYTGNFILGNE
NGKEGYCYQKRDGVCFETQYYPNSCNISNFPSCLKNAGEPFESVTIYKFSVKK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatctcaaagaccgtttggtaagaccaagcagggagaaaaagtaacattatat
acgataacaaatgatcatggtatggtggtatccttcagtgattttggtgctaatattgta
agtattatagtaccggacaagaatggtacatttgcggatgtagcattagggtatgataat
gtaaaacaatatgaagtgaatggaccaggatacggttcttttattggtcgtcatgcgaat
cgtatcgcagaagctttggttgtaataaatgggaaagagtacaaattagaaaagaacgat
ggcaatcacaatttacatagcggtagtaaaggctataataaattcctatatgaaactgaa
gtctttaaagacaaggatgagacaacagtagagttttccagattaagtcctgatatggaa
cagggattaccgggtaatcttgatcttgtggtttcctataccttaacaaatgataatgaa
ttggctattgaatattatggagtatcagataaggatacaattattaactttaccaatcat
tcttattttaatttggctggccataatagcggaagtatagaaggtcatcaggtaatgatt
gattcagatgaatttacattaacagatgaaacgttaattcctacaggcgaaattgcaaag
gtagaaggaacaccaatggattttcgtaaattgaagaaaataggaaaagatattgaagca
gattatcaacctcttcgcgttgctggtgggtatgatcataattatgttttaaaaacctca
gaagaggaagcagctaaagttgctgaactttgggaggaaaagagcggacgcctcatggag
gtatttaccgacgcgaaaggtcttcagctctatactggtaattttattcttggaaatgaa
aatggaaaagaaggatattgctatcagaaacgtgatggagtttgctttgaaacacaatat
tatccaaattcctgtaatataagtaattttccatcctgtcttaagaatgcaggagaacct
tttgaaagtgttacgatctataaattctcagtgaaaaaataa

DBGET integrated database retrieval system