KEGG   Lachnoclostridium phytofermentans: Cphy_0858Help
Entry
Cphy_0858         CDS       T00619                                 

Definition
(GenBank) glycoside hydrolase family 30
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
cpy00511  Other glycan degradation
cpy00600  Sphingolipid metabolism
cpy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Cphy_0858
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cphy_0858
Enzymes [BR:cpy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Cphy_0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydr_30_2 DUF5442 Cyc-maltodext_C
Motif
Other DBs
NCBI-ProteinID: ABX41244
UniProt: A9KLB5
Position
1097657..1098994
Genome map
AA seq 445 aa AA seqDB search
MRIRTVTTDYHKNLFLLESERFIATEVGCNQVVAIYPELTYQTIRGFGGAFTESSGYNFS
KLSKEKKNIVLNAYFGKDGIHYTLGRTHINSCDFSLSNYSYLEEDEDINQKFNRDRDREY
IVPMIKAAIELSEDNITFLASPWSPPSFMKTNLDMNHGGELKEEYKRDWAKYIAAYIKDC
KKDGITISMLTVQNEPEATQVWDSCRYSATQEMEFVRDYLGPILAEEGLSDVKIYVWDHN
KELLYERAKVILSDKNAREYISGVAFHWYTGDHFEALDLVREHFPEQELLFTEGCVEYGR
FFDSSEVWKAEMYAHDILGNLNHGMHGYMDWNLLLDDKGGPNHVGNFCQAPIMCNAEEDS
IQFNLSYYYIGHFSKYIMPGAKRIAYTKYSDLVEVAAFINPNKERVVVLLNKSEKEVTVV
LKENGIGQEIKVNSHSIVSVICSEE
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagaattaggacagtaactacagattatcataagaatctatttttactagaatcagag
agattcattgcaactgaagtaggatgtaatcaagttgttgccatatatccagaattgacc
taccagaccattcgaggatttggcggcgcttttacggagtcttccggctataatttttca
aagcttagcaaagaaaagaaaaacattgttctgaatgcttattttggtaaggatggaatt
cattataccttaggaagaactcatatcaatagctgtgatttttcactttctaactattct
tatcttgaagaagatgaggacatcaatcaaaagtttaaccgtgatcgagacagagaatac
attgtcccaatgataaaagctgcaatcgaacttagtgaagacaatattactttcctagca
tccccttggtcgcctccttcgtttatgaagacaaacctcgatatgaatcatggcggggaa
ttaaaagaggaatataaaagagattgggcaaaatacatagcagcttatataaaggactgt
aaaaaagatggaattacgatttccatgcttactgtacaaaatgaaccggaagcaactcag
gtttgggattcctgccgctacagcgcaacgcaggaaatggaatttgtcagagattatctg
ggaccaatcttagcagaagaaggtttaagtgacgtaaaaatctatgtttgggaccacaac
aaagaactattgtatgagcgtgcaaaggtaatcctttctgataaaaatgcaagagaatat
ataagcggagttgcgtttcattggtataccggggatcattttgaagctcttgatttagta
agagaacattttccagaacaagaactattattcacagaaggttgtgttgagtatggaaga
ttttttgattcctccgaggtttggaaggcagaaatgtatgctcatgatatcttaggtaac
ctaaatcatgggatgcatggatatatggactggaatctattacttgatgataaaggtgga
ccaaatcatgtaggaaacttctgtcaagctccaatcatgtgcaatgcagaggaggatagt
atacagtttaatctttcttactattacataggtcactttagtaaatacattatgcctggt
gctaaacgtattgcttatactaagtattcggatttagtagaggtagcagcatttattaat
ccaaataaagaacgggttgttgttttacttaataaatcagagaaagaggtaacagtagta
ctaaaggagaatggaattggtcaggaaattaaggtgaattctcatagtattgtttcagtg
atttgttcagaagagtaa

DBGET integrated database retrieval system