KEGG   Clostridium phytofermentans: Cphy_1301Help
Entry
Cphy_1301         CDS       T00619                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
cpy  Clostridium phytofermentans
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cpy00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cpy00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1627659..1628696)
Genome map
AA seq 345 aa AA seqDB search
MSRTIYVSKDKTSEHEFSTITDALSSIPEGTIEPVTIFIKKGTYKEKLIIKQPNLTLIGE
SKEETILTFDDYANMIMEDGSKRGTFRTPSVFIDANDFTAKNLTFQNNSGYGHQVGQALA
LYVDGDRMVFDNCILLGSQDTLFTAPLPPSANQLGGFTGPKEFEPRVNGRHYYRNCYIRG
DVDFIFGSATSFFDHCEIFSQKTDDLPPAKQGEEQKNYGYITAASTAEGQEYGYVFSHCR
LTSDCPKHSIYLGRPWRNFAKTVFLHCEIGEHIREEGWHDWNKPEAHKTMLYAEYQSTGE
GSKAITEGKRASFSKQLSDYEALKYTKEKVLAGDDNWVPSLVLAD
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaacgatttacgtatccaaagacaaaacatcagaacatgaattttctacgatt
actgatgcactctcaagtattccagaaggaactatagagccggtaactatttttattaag
aagggaacatacaaagaaaaacttatcattaagcagcctaacttaaccttaattggtgaa
tcaaaagaagagaccatacttacctttgatgattatgctaacatgattatggaagatggc
agtaaaagaggaacgtttcgcaccccttctgtattcattgatgctaatgatttcacagca
aagaatctcacttttcaaaataactctggttatggtcatcaagtaggacaagcacttgca
ctttatgtggatggagaccgaatggtatttgataattgtattcttcttggtagtcaagat
accttatttacagctccactccctccatcagcaaaccaacttggtggttttactggacca
aaagagtttgaaccacgagtaaatggtcgtcattattatcgtaactgttatattcgaggc
gatgttgattttatctttggaagtgcaacttcattttttgatcactgtgaaattttttct
caaaagacagacgatcttcctcctgcaaaacaaggagaagaacagaagaactatggctat
ataactgcagcaagtactgcagaaggacaggaatatggatatgtcttttctcattgccgt
ctaaccagcgattgcccaaaacatagcatatatttaggaagaccttggcgaaactttgct
aagacagtatttctacattgtgaaattggggagcatattcgtgaggaaggttggcatgac
tggaataaaccagaagctcataaaacgatgctttatgcagaatatcaaagtactggtgaa
ggttcaaaagctatcactgaaggaaaacgagcttctttttctaagcagctctcagattat
gaagcacttaaatataccaaggaaaaagtattagctggtgatgataactgggtaccatct
ttagtactagctgattag

DBGET integrated database retrieval system