KEGG   Lachnoclostridium phytofermentans: Cphy_1333Help
Entry
Cphy_1333         CDS       T00619                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cphy_1333 (ruvA)
Enzymes [BR:cpy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Cphy_1333 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1664452..1665063
Genome map
AA seq 203 aa AA seqDB search
MLAFIQGELAEVKENYVVVDNNGMGYEIFIPHTVHSYLPAIGDKVKFHTYLQVREDGMAL
FGFLNREDLAMFKLLITVNGIGPKGAIGILSAISTDDLRFAVLAEDVKAISKAPGIGTKT
ASKLILELKDKFKLEDAFEATFQSNQVISTGGKGNNDGIREEAIQALVALGYSATDALKA
VKAVEITSNMTSEDVLKFSLRNF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgttagcatttatacaaggcgaattagctgaggttaaagaaaattatgttgtcgtagac
aacaatgggatggggtatgagatttttataccacatacagtccattcttatttgcctgcg
attggagataaagtaaaatttcatacgtatcttcaggtaagggaagatggcatggcgtta
tttggcttcttaaatcgtgaagatttagcgatgtttaaattgttgattacagtaaatgga
attggtccaaaaggtgcaataggtatcttatcagcaatatcaaccgatgatttacgtttt
gctgtgttagcagaagatgtgaaggcaatttctaaagctccagggattggaacaaaaact
gcaagtaagttaattttagaattaaaggacaagttcaagttagaggatgcttttgaagct
actttccagtcgaatcaggtgatatctactggaggaaagggcaataatgatggaattcga
gaagaagccatccaagcattggtagcccttggatattctgcaacggacgctcttaaggct
gttaaggcagtagaaattacatcaaatatgacgtcagaggatgtgcttaagtttagtttg
cgcaatttttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system