KEGG   Clostridium phytofermentans: Cphy_1371Help
Entry
Cphy_1371         CDS       T00619                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cpy  Clostridium phytofermentans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cpy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1710625..1712133
Genome map
AA seq 502 aa AA seqDB search
MKKGKVWLVGAGPAETDLLTIKAKKAIEQADVVVYDRLVGQGILMMIPEDVKCIDVGKCA
GNHTMPQKQINQILLQEAMSGKQVVRLKGGDPFLFGRGGEELELLSEYDIPFEIVPGITS
AISVPAYHGIPVTHRDYCSSVHIITGHRGKDKPYDIDFDALVRTKGTLVFLMGASALGDI
CDGLMRAGIETDMPAAILQKGTTSKQKQIVATIGTLEQEVKRQGVETPAIIVVGKVCQLA
NDFSWYEKRPLSGKKIVVTRPKELVSTLSEKLKSKGAEVLEIPTIRIAPLKNNIVLKNTL
LQLDQFQWLVFTSPSGVDVFFNAMKEEKIDIRKLANLKVAVVGEGTKKKVEDRGILVDLI
PENYYGKSLGKSIRMSCCDGDRILIPRASIGNEEIMEEIKKNPLLEVMDIPIYDTVYSTP
DIINLKDEFERGNIDFAVFTSKSTVTGFVKATKDLDYHLVNAVCIGEQTRDEAQKNNMKT
WMSKKATIDSLVETIEELASVI
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagggaaggtttggcttgtaggagcaggtcctgcagaaacagacttactgaca
attaaagcaaaaaaggcaatcgagcaggctgatgtggtagtttacgacagactggttggt
cagggaatcctgatgatgatacctgaggatgtaaaatgtattgatgttgggaagtgtgct
ggaaatcatacgatgcctcaaaaacaaattaatcaaattttattacaagaagctatgtct
ggcaaacaagttgtacgcttaaaaggtggagatccgttcctatttggaagaggcggagaa
gaactcgagttgttaagtgaatatgacataccctttgaaatagtacccggtataacatct
gccatatccgtaccagcatatcatggaattccggtaacccatcgtgattattgttcttcc
gttcatatcattacggggcataggggaaaagataagccctatgatatagattttgatgca
cttgttcgcaccaagggaacgctggtatttttgatgggggcttccgctctgggagatatt
tgcgatggattaatgagggcaggtatagaaacagatatgccagctgcaatcctacaaaaa
ggtactacatcaaagcaaaaacaaattgttgcgacaattggtacgctagaacaggaagta
aaaagacaaggggtcgaaactccagcaattatcgtagtggggaaagtatgtcagctagcg
aatgatttttcctggtacgaaaaacgtccattatcaggtaagaagattgtggttaccaga
ccgaaggagctagtttcaactctttctgaaaagctgaaaagtaagggagctgaagtattg
gagattccaaccatacgaattgctccattaaaaaataatattgttttgaaaaatacactt
ttgcaactagatcagtttcaatggctggtatttacaagcccttccggagtagatgtcttt
tttaacgcgatgaaggaagaaaaaatagacatcagaaagctggctaatctaaaagttgca
gttgttggtgaaggaaccaaaaagaaagtggaagacaggggaatcctggttgacctgatt
ccggaaaattactatgggaaatcccttggaaaatcaatcagaatgagttgctgcgacgga
gatagaatccttattccgagggcaagtattggaaatgaagaaatcatggaagagattaaa
aagaatccactgttggaagttatggatattccaatctatgatacggtatattctacacca
gacataattaacttaaaggatgaatttgaacgtggaaatattgattttgccgtatttaca
agtaaatctacggtgacgggatttgtcaaggcaacaaaagacttggattatcacttagtg
aatgcagtttgtattggagagcagaccagggatgaagcacagaaaaataatatgaaaacc
tggatgtcaaaaaaggctacaattgatagtcttgttgaaacgatcgaagagttagcaagt
gttatatag

DBGET integrated database retrieval system