KEGG   Lachnoclostridium phytofermentans: Cphy_1818Help
Entry
Cphy_1818         CDS       T00619                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cphy_1818
Enzymes [BR:cpy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Cphy_1818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2246773..2247699
Genome map
AA seq 308 aa AA seqDB search
MKKLIVLGSLNMDLSIQSDYMPRSGETINGYGFLMNSGGKGGNQAVSAAKLGVDVKMIAN
VGNDIFGKQLLDDLNSYGVDVSSVEVSNNVSSGVAMITRCNNDNRIILSNGANHTLDFET
VKEKLIKIANPGDIFLTQLENDFEVVKKSIKFAKELGLYTILNPAPAKVIEDDLYKHLDL
VIVNQSECELLTGIYPEDEKSYHIALEVFRDKGVNAIITLGTDGSITNYTGDYEYIASRK
VKTVDTTAAGDSYIGALCRFLIFEKDFIEGLTFASDVAALTVTKKGAQISIPNFNEVKEY
FKEDRNYE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactaattgtattaggaagtctaaacatggacctttcaattcaaagtgattat
atgccaagaagcggtgaaactattaatggatatggtttcctaatgaactctggtggtaag
ggcggcaaccaagccgtttcagcagcgaaacttggtgtggatgtgaagatgattgcgaat
gttggaaatgatatttttggtaagcaattattagatgacttaaattcttatggagtggat
gtctctagtgttgaggtatcaaacaatgtatcttctggcgttgctatgataacaagatgt
aacaatgataatcgaattatcttaagcaacggtgcaaatcatactctagattttgaaact
gtgaaagagaagttaataaagattgcgaacccgggagacattttcttaacccaattagag
aatgatttcgaagttgttaaaaaatcaattaagtttgcaaaagagcttggactttatacc
attttaaatccagcacctgcaaaagttattgaagatgatttatataagcatttagattta
gtaattgtaaatcaaagtgaatgtgagctgttaactgggatttatccagaggatgaaaaa
tcttatcatattgcgctggaggtatttcgtgataaaggagtaaatgcaattattacgctt
ggtacagacggtagtattacgaattatactggtgattatgagtatattgcatcaagaaaa
gtaaaaacagtagatacaactgcagcaggagattcttatataggagctctatgtcgtttc
ttaatctttgagaaagattttatagaaggcttaacgtttgcttctgatgtggcagctttg
accgtaaccaaaaaaggtgctcaaatctcaatacctaattttaatgaagtgaaagaatat
tttaaggaggatcgaaattatgaataa

DBGET integrated database retrieval system