KEGG   Lachnoclostridium phytofermentans: Cphy_1900Help
Entry
Cphy_1900         CDS       T00619                                 

Definition
phosphoglycerate mutase
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cphy_1900
   01230 Biosynthesis of amino acids
    Cphy_1900
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cphy_1900
  Energy metabolism
   00680 Methane metabolism
    Cphy_1900
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cphy_1900
Enzymes [BR:cpy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Cphy_1900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2344104..2344670)
Genome map
AA seq 188 aa AA seqDB search
MNIYFIRHGETDWNVENKIQGSNDIDLNENGINQALALGEKVKTQGLPIHKVYSSPQKRA
RKTAKILSEALQVDHIVKAGLEEMNLGRWEGFTWKEVKETDSETFNIWHANRNTKETPDG
ESYEEVLSRSIAAIQSILKNESQDIAIVSHGAVIKCLLCYINKVPFDQMKQFQTGNTSIT
IMDAAHFR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttattttatacgacatggtgaaaccgattggaatgttgaaaataaaatacag
ggtagtaatgatatagatttaaatgaaaatggaatcaatcaagcattagctcttggagag
aaagtaaaaacacaaggattgcctattcacaaggtatattcaagtccacaaaaaagggca
cgcaaaactgctaaaatattaagcgaagccttgcaggtagatcatatagttaaagctgga
cttgaagagatgaatcttggtcgttgggaagggtttacttggaaagaagtaaaagaaact
gacagtgaaacctttaatatatggcatgcaaatcgaaatacaaaagaaactcccgatgga
gaatcttacgaggaggttctctcccgctctatagcggctatacaatctatcctaaaaaat
gaatctcaggatattgcaatcgtaagtcatggtgctgttattaaatgtttactatgctat
attaacaaggtaccatttgatcagatgaagcaatttcaaacaggaaatacttctattacg
atcatggatgccgctcattttagatag

DBGET integrated database retrieval system