KEGG   Lachnoclostridium phytofermentans: Cphy_1900Help
Entry
Cphy_1900         CDS       T00619                                 

Definition
(GenBank) Phosphoglycerate mutase
Organism
cpy  Lachnoclostridium phytofermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 PYNP_C
Motif
Other DBs
NCBI-ProteinID: ABX42269
UniProt: A9KT58
Position
complement(2344104..2344670)
Genome map
AA seq 188 aa AA seqDB search
MNIYFIRHGETDWNVENKIQGSNDIDLNENGINQALALGEKVKTQGLPIHKVYSSPQKRA
RKTAKILSEALQVDHIVKAGLEEMNLGRWEGFTWKEVKETDSETFNIWHANRNTKETPDG
ESYEEVLSRSIAAIQSILKNESQDIAIVSHGAVIKCLLCYINKVPFDQMKQFQTGNTSIT
IMDAAHFR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttattttatacgacatggtgaaaccgattggaatgttgaaaataaaatacag
ggtagtaatgatatagatttaaatgaaaatggaatcaatcaagcattagctcttggagag
aaagtaaaaacacaaggattgcctattcacaaggtatattcaagtccacaaaaaagggca
cgcaaaactgctaaaatattaagcgaagccttgcaggtagatcatatagttaaagctgga
cttgaagagatgaatcttggtcgttgggaagggtttacttggaaagaagtaaaagaaact
gacagtgaaacctttaatatatggcatgcaaatcgaaatacaaaagaaactcccgatgga
gaatcttacgaggaggttctctcccgctctatagcggctatacaatctatcctaaaaaat
gaatctcaggatattgcaatcgtaagtcatggtgctgttattaaatgtttactatgctat
attaacaaggtaccatttgatcagatgaagcaatttcaaacaggaaatacttctattacg
atcatggatgccgctcattttagatag

DBGET integrated database retrieval system