KEGG   Lachnoclostridium phytofermentans: Cphy_2025Help
Entry
Cphy_2025         CDS       T00619                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Cphy_2025
  Lipid metabolism
   00600 Sphingolipid metabolism
    Cphy_2025
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cphy_2025
Enzymes [BR:cpy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Cphy_2025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2500417..2502339
Genome map
AA seq 640 aa AA seqDB search
MKADLTWLDNPEVFRVNQLAAHSDHPFYKSKEEMELSTSEVPFSQNFTEKNSLLQSLNGT
WQFRYSVSAKERPEYFYQEDFIGSDFDEIAVPCHIELAGYDKIHYINTMYPWEGHYYRRP
AYCLGNDSLRGTFSEASYNPVGSYRKRFDIEKGLLGKRVCISFEGVEQAMYIWLNGQFIG
YAEDSFTPSEFDLTPYIKEKDNILAVEVHKRSTAAFLEDQDFFRFFGIFRNVTLYAKPEI
HIEDMWVKPQLNEDNSSGKLGLELKISNRIELGTITLKVQDDNHKIILEKSIEAKEKVSY
ESNVIENIIPWSYKNPYLYTVNLEVYDNSGCLVEIVPYRIGFRRIEIKDKLILLNGKRLI
INGVNRHEWSQTSGRCINLSDMQTDMKLILQNNINAVRTSHYPNQIPWYYLCDVSGIYVM
SETNLESHGSWQKLGAIEPSWNMPGSILQWKEAVVDRARTNFETFKNHTSILFWSLGNES
YAGDNIESMNQFFKENDASRLVHYEGVVNNRAYESTISDVESRMYASSKQIEEYLESDPA
KPFILCEYMHDMGNSLGGLKSYIDLIPRYEMYQGGFIWDFIDQALLVKDEISGEMVLRYG
GDFDDRPSDYEFSGDGIVFADRTEKPSVQEVKYYYGLYQS
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagatttaacatggttggataacccagaagtgtttcgtgtcaatcagttagca
gctcacagtgatcaccctttttacaagagtaaggaggagatggaactaagtacttccgag
gttccctttagtcagaattttaccgagaaaaactccttactacaatcgttaaatggtacg
tggcagtttcgatattctgtgagtgcaaaagaaagaccagagtatttttatcaagaagat
tttatcggaagcgacttcgatgaaattgcggttccatgtcatattgagttagcaggttat
gataaaatacattatattaatacgatgtatccatgggaaggccattactatcgaagaccg
gcgtattgtttaggaaatgatagtttgagaggaacctttagtgaggcttcttataatccg
gttggatcttatcggaaacgctttgatatagagaaaggcttacttggaaaaagagtgtgc
ataagttttgaaggcgtagaacaagcaatgtatatctggttaaatgggcaatttattggt
tatgcagaagatagttttaccccttccgaatttgatttaacaccttacataaaggaaaaa
gataatattttagcggtagaagttcataaaagaagtacggccgcttttcttgaagatcag
gatttcttccgattctttggtatctttcgaaatgttaccttgtatgcaaaacctgagata
catattgaagatatgtgggttaaaccacaattaaatgaagataactcttcaggaaaactt
ggacttgagttaaagatatcgaatcggattgaattagggacgataacacttaaggttcaa
gatgataatcataaaattatacttgaaaaaagcatagaagcgaaagaaaaagttagttat
gaatcaaatgtaatagagaatattattccttggtcatataaaaatccatatttatatacg
gtaaatcttgaagtatatgataacagtggatgcttagttgaaattgtaccatatagaata
ggatttcgaaggattgaaatcaaggataaacttatacttctcaatggaaaacgactaata
attaatggtgtgaaccgccatgagtggagtcagaccagtggaagatgtattaatttatct
gatatgcagacagatatgaaactgattcttcaaaataatattaatgctgttcgtaccagc
cattatccaaatcagataccttggtattatctttgtgatgttagtggcatctatgtcatg
tctgagacgaacttagaatctcatggctcatggcaaaagttgggagctatagaaccttct
tggaatatgccgggtagtattctacagtggaaagaagccgtagttgaccgtgcgagaact
aattttgaaacctttaagaatcatacctcaatactattttggtccctagggaatgaatcc
tatgcaggagataatatcgagagtatgaatcaattctttaaagaaaatgatgctagtaga
cttgtacattatgaaggagtagtgaataacagagcttatgaatctactatatccgatgta
gagagccgtatgtatgcgtcttctaaacaaatagaagaatatttggaatcagatccagca
aaaccttttattttatgcgaatatatgcatgatatgggaaattctttgggtgggctgaaa
tcatatattgacttgatacctcgttatgagatgtatcaaggtggatttatttgggatttt
atcgatcaagcattattagtaaaggatgagatatcaggtgagatggtacttcgatacgga
ggagacttcgatgacagaccttctgactatgaattctcaggagatggaatcgtatttgca
gatagaacagaaaaaccatcagtacaggaggtgaaatattactatggattgtatcaatca
taa

DBGET integrated database retrieval system