KEGG   Clostridium phytofermentans: Cphy_2031Help
Entry
Cphy_2031         CDS       T00619                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cpy  Clostridium phytofermentans
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Cphy_2031
Enzymes [BR:cpy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Cphy_2031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2510093..2510728
Genome map
AA seq 211 aa AA seqDB search
MKERMDERMKNKKEELKREVVLTAKRALKEGMVAGTSGNISVFLEDLNAMAITPSGYDYT
IMEENDVVVISLDGTVLEGHLKPSSEWKLHAEIYKNLPHVKSVVHTHSPYATSFAVLHKE
IPVILIEMVPFLKGSIEVSPYAKQGSSDVGSNAVPILGRKNACLMANHGVVAVGDTLGQA
YINSIYVEDAAKIYHMALTVGTPVVLTEDLW
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaagaatggatgaaagaatgaaaaacaagaaagaagaattaaaaagagaagta
gttttaaccgcaaaaagagcattgaaagaaggcatggttgcaggtactagtggtaatata
agcgtatttctagaagatttaaatgcaatggctattacaccaagtggatatgactatact
atcatggaggaaaatgatgttgttgtcatttctttggatggtacggtattagaaggtcat
ctaaagccttcttctgaatggaaacttcatgcagaaatttataaaaaccttccgcatgtg
aagtcagtagtgcatacgcattccccttatgctaccagctttgcggtacttcataaagaa
attccagttatactcattgagatggtaccattcttaaaaggaagtatcgaagtgagtcct
tatgcaaaacagggaagtagtgatgttggctcaaatgcagtacctatcttgggtagaaaa
aatgcatgtttaatggctaatcacggtgtggttgcagtcggagatacattaggacaagca
tacatcaacagtatctatgtagaagatgccgctaaaatttatcatatggcgttaactgtg
ggaactccggtagtattaacggaagatctatggtaa

DBGET integrated database retrieval system