KEGG   Clostridium phytofermentans: Cphy_2058Help
Entry
Cphy_2058         CDS       T00619                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cpy  Clostridium phytofermentans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cpy00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2542002..2543411
Genome map
AA seq 469 aa AA seqDB search
MCVELMRKFPIIVSGILVCATLLSGCSQNMSNVDKSTVNLNSQNTDNQNQDANNKDSDNQ
GANNQESNNQESQNPELKNTPTPQIIVLPGDSTIEANEIVAPTITFEQKEIPSNPAITFV
HNMKIGWNLGNTFDAVSDSNLMDELNYESSWCGVKTTEEMMKAIKDAGFQSIRIPVSWHN
HVSGDDFIISEVWLNRVQEVVDYAINNDMYVILNTHHDVSKNFYYPSNENLESSKKYINA
VWTQVSERFSSYGEKLLFEGMNEPRLAGSNYEWWLDLSKPECKEAIECINQLNQEFVDTV
RKSGGENTSRYLLIPGYDASSQYALINDYKLPKDNINDRLIVSVHAYLPYDFALKSPKES
GSISEWNSKIAGCTKEIDSFLNSLYMKFIKNGVPVIIGEFGARDKENNLESRVEYATYYI
GAAKANGITCFWWDNHAFKGDGENFGLFDRKSCTIKYPEILQGLMKYAE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgttgaattgatgagaaagtttccaattatagtatcaggtattttagtatgtgca
acattattaagtggctgtagccaaaatatgtcaaatgttgataaatccacagtgaatttg
aattcgcagaatacagacaatcaaaatcaagatgcaaataataaagactcggataatcaa
ggcgcaaataatcaagagtcaaataatcaagaatcacaaaaccctgaattaaaaaataca
ccaacacctcaaatcatagtactaccaggtgacagcacaattgaagcaaacgaaattgta
gccccaaccatcacatttgaacaaaaagaaataccatcgaatccagcaataacttttgta
cataatatgaaaataggatggaaccttggaaatacatttgacgcagtgagtgattccaat
ctaatggatgaacttaattatgaaagctcatggtgtggtgtaaaaacaacagaagagatg
atgaaagcaattaaagatgctgggtttcagtcgattagaataccagtatcgtggcacaat
catgtttctggtgatgattttattataagcgaagtatggcttaaccgagtacaagaagtg
gtcgattatgctatcaataatgatatgtatgtgatattaaatactcaccatgatgtaagt
aaaaatttttattatccaagtaatgaaaatttagaatcttctaaaaaatatatcaacgca
gtatggacacaagtaagtgaacgattttcttcctatggagaaaagttattatttgaaggg
atgaacgaaccaaggcttgcaggttctaattacgaatggtggttagatttatcaaagcct
gagtgtaaagaagcaatcgaatgtattaatcaattaaatcaggaatttgttgataccgtt
cgcaaatcgggaggagagaatacttctaggtatcttctgataccagggtatgatgcatcg
tctcaatatgcacttattaatgattataagttaccaaaagataatataaatgatcgttta
attgtatcagtacatgcatatctaccatatgactttgccctaaaaagtccaaaggaaagt
ggcagtatatcagaatggaattcaaaaatagctggatgtactaaggagatagattctttt
ttaaatagtttatatatgaagtttataaaaaatggagttcccgtaattatcggtgaattt
ggtgccagagataaagaaaataatttagaatctcgggtagagtatgctacttattatata
ggtgctgcaaaagcgaatggaatcacatgcttctggtgggataatcatgcatttaaaggg
gacggggaaaacttcggtctttttgatagaaagagttgtactataaaatatcctgagata
ttgcaaggtttaatgaaatacgcagaataa

DBGET integrated database retrieval system