KEGG   Clostridium phytofermentans: Cphy_2334Help
Entry
Cphy_2334         CDS       T00619                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cpy  Clostridium phytofermentans
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cpy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2876608..2877192
Genome map
AA seq 194 aa AA seqDB search
MSIDKNLIQESVSNILIALGEDPLREGLIDTPKRVANMYEEVFLGIQYTNDDIVTMFNKC
FEEDQNTFLANGIVWIKDIECFSFCEHHMTLIYDMHITIGYKPLHKVIGISKIARIADMV
CKRLQIQERIASDILEILTKITGSDDIFIKIEGKHGCMTSRGIQKPHATTCTILTSGIFQ
HNPMSFITKESGHV
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgacaaaaatttgattcaagagagcgtgtctaatattttaattgctcttgga
gaagaccccttaagagaaggtttaatcgatacgccgaaacgagtcgcaaatatgtatgag
gaagtttttttaggaattcaatatacaaacgatgatattgttaccatgtttaataaatgc
tttgaagaagatcaaaatacatttctcgcaaatggtattgtatggattaaggatatcgaa
tgctttagcttttgtgaacaccacatgactttaatatacgatatgcatatcaccattgga
tataaaccacttcataaagtaattgggataagtaaaatagcacgtattgcagatatggta
tgtaagaggctgcaaattcaagagaggatcgcctctgatatcttagaaattcttactaaa
attacgggaagtgatgatatctttattaagattgaggggaaacacggatgcatgacctct
cgtggaatccaaaagccacatgctacgacatgtacaatcttaacaagtggaatctttcaa
cataatcctatgtcgttcatcacaaaggagagtggtcatgtatga

DBGET integrated database retrieval system