KEGG   Lachnoclostridium phytofermentans: Cphy_2349Help
Entry
Cphy_2349         CDS       T00619                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cphy_2349
Enzymes [BR:cpy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Cphy_2349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2899812..2901263)
Genome map
AA seq 483 aa AA seqDB search
MREAGILLPLSSLPSNHGIGDMGSYSFELIDLLKAGGFRIWQILPINPLGYGNSPYQPYS
SFAGDEIYISLDELYKDGLFTNKPPEFQKYSKSVDYENVRKFKEIYLKEAFLKFTEDTDY
KEFIKQEWVYLYAVFLTLKKKNELRCWNEWDKEQKEWIKSREFDVSLYEEEIRYEMFVQY
IFYKQWMKIRTYANQNGIRIMGDIPFYVGIDSLDVWANQECFLLGADGKPTFVAGVPPDY
FSVTGQRWGNPIYDWDYLKKQNYQFWLDRIAYSSKLFDIIRIDHFRAFDTYWKIPATCET
AVEGEWLEAPGYDVFDLIVKKYPEVEIVAEDLGDLREEVHVLKNHYGLKGMKIVQFTFDP
NENNNNFEDIENMVIYTGSHDNQTISGWYLSQDEKTQNEIRKSLMKSGYDDTIISKRFVR
LTLDSIAEMAILPLQDLINLGDEARINTPGTLGSPNWEWKLDSFNEFKEEIGNLKECIIA
SRR
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagcaggaatactattacctttatcatccttaccgtcaaatcatggaattggt
gatatggggtcatatagttttgaattgattgatttattaaaagcaggtggttttcgcata
tggcagatattgcccattaatcctttaggatatggaaattcaccttaccagccatactcc
tcatttgcaggtgatgagatttatataagtcttgatgaattatataaggatggtttattc
acaaataaaccgccagagtttcaaaaatatagtaaatctgttgattatgaaaatgtaaga
aaatttaaagaaatttatttaaaagaagcttttcttaagtttacagaggatactgattat
aaggagtttataaaacaggaatgggtatacctttatgccgtatttcttacactaaaaaag
aaaaatgagttaaggtgttggaatgaatgggataaagaacagaaggaatggataaagtca
agagagtttgatgtatctttatatgaagaagagatacggtatgaaatgtttgttcagtat
atcttctacaaacaatggatgaagataaggacttatgcgaatcaaaacggcattcgtatc
atgggcgatataccattttatgtgggaatagactctttagatgtctgggcaaaccaagag
tgctttttacttggggcagatggaaaaccgacatttgttgcaggagtgcctccagattac
tttagtgttactggtcaaagatggggaaatccaatctatgactgggattatttaaaaaag
caaaattatcagttttggttagaccgaattgcttatagcagtaaactgtttgatattatc
cgtattgatcatttccgtgcttttgatacttattggaaaatacctgccacctgcgaaact
gcagtggagggtgaatggctagaagcgcctggctatgatgtgtttgacttaattgttaag
aagtatccagaagttgaaattgttgctgaagacttaggggatttaagggaagaagttcat
gtacttaaaaaccattatggattaaagggaatgaaaatcgttcaatttacatttgatcca
aatgaaaataacaataattttgaagatattgaaaatatggttatttatacgggaagtcat
gacaatcaaacaataagtggctggtatttatctcaggatgaaaagacacagaatgagatt
aggaaatctctaatgaagtcaggctatgacgatacgattatttccaaacgatttgtaaga
cttactttagatagtattgcagagatggcaatcctaccgttacaggatttaattaattta
ggtgatgaagctagaattaatactcctggtacacttggctcacctaattgggaatggaaa
ttagatagctttaatgaatttaaagaagaaatcggtaatttaaaggaatgcattattgct
agcagacggtaa

DBGET integrated database retrieval system