KEGG   Lachnoclostridium phytofermentans: Cphy_2651Help
Entry
Cphy_2651         CDS       T00619                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cphy_2651
   01230 Biosynthesis of amino acids
    Cphy_2651
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cphy_2651
  Energy metabolism
   00680 Methane metabolism
    Cphy_2651
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cphy_2651
Enzymes [BR:cpy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cphy_2651
Exosome [BR:cpy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cphy_2651
  Exosomal proteins of melanoma cells
   Cphy_2651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3237415..3238164)
Genome map
AA seq 249 aa AA seqDB search
MKLVLLRHGESEWNKENLFTGWMDVDLSETGKAEAASAGITLKQKGYDFDVCYTSYLKRA
IHTLNLALDEMDRVWLPVVKSWKLNERHYGTLQGLNKSETAERYGEEQVKIWRRSYDIAP
PLLKEEDERNPRFQEQYRQEKCEILPLGESLKDTIARVVPYYNEVILKDMMAGKRVLIAA
HGNSLRALMKYLEDMSPEDILNVNLPTGIPLVYELDEEGKFISKEYLGDAEYVKAKIEKV
SAQGKVTIE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagtattattaagacatggcgaaagtgaatggaataaggaaaatttatttact
ggttggatggatgtcgatttgtctgaaactgggaaagcagaagcggcctctgcaggcatc
acgctgaaacaaaagggatatgattttgatgtctgttatacttcttacttaaaacgtgcg
attcataccttaaacttagcgttggatgagatggacagagtatggctacctgtcgtgaaa
agctggaaactcaatgagagacattatggtacgttacaaggattaaataaatcagagaca
gcagagagatatggagaggaacaggttaaaatctggagacgtagttatgatatcgcacca
cctctacttaaagaagaagacgaacgaaatccaagatttcaagagcaatatagacaagaa
aaatgtgagatacttcctttaggagaaagcctaaaagatactattgcgagagtagttcct
tattataacgaagtcatattaaaagatatgatggcaggaaagagagtgttaatagcagca
catggtaattcactacgtgcactgatgaaatatttggaagatatgtctccagaagatata
ttaaatgttaatcttcctactgggatacctttggtttatgaacttgatgaagaaggaaaa
tttattagtaaagagtatcttggagatgcagagtatgtaaaagctaagatagaaaaagta
tctgctcaaggaaaggttacaattgaataa

DBGET integrated database retrieval system