KEGG   Lachnoclostridium phytofermentans: Cphy_2651Help
Entry
Cphy_2651         CDS       T00619                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cphy_2651
   01230 Biosynthesis of amino acids
    Cphy_2651
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cphy_2651
  Energy metabolism
   00680 Methane metabolism
    Cphy_2651
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cphy_2651
Enzymes [BR:cpy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cphy_2651
Exosome [BR:cpy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cphy_2651
  Exosomal proteins of melanoma cells
   Cphy_2651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3237415..3238164)
Genome map
AA seq 249 aa AA seqDB search
MKLVLLRHGESEWNKENLFTGWMDVDLSETGKAEAASAGITLKQKGYDFDVCYTSYLKRA
IHTLNLALDEMDRVWLPVVKSWKLNERHYGTLQGLNKSETAERYGEEQVKIWRRSYDIAP
PLLKEEDERNPRFQEQYRQEKCEILPLGESLKDTIARVVPYYNEVILKDMMAGKRVLIAA
HGNSLRALMKYLEDMSPEDILNVNLPTGIPLVYELDEEGKFISKEYLGDAEYVKAKIEKV
SAQGKVTIE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagtattattaagacatggcgaaagtgaatggaataaggaaaatttatttact
ggttggatggatgtcgatttgtctgaaactgggaaagcagaagcggcctctgcaggcatc
acgctgaaacaaaagggatatgattttgatgtctgttatacttcttacttaaaacgtgcg
attcataccttaaacttagcgttggatgagatggacagagtatggctacctgtcgtgaaa
agctggaaactcaatgagagacattatggtacgttacaaggattaaataaatcagagaca
gcagagagatatggagaggaacaggttaaaatctggagacgtagttatgatatcgcacca
cctctacttaaagaagaagacgaacgaaatccaagatttcaagagcaatatagacaagaa
aaatgtgagatacttcctttaggagaaagcctaaaagatactattgcgagagtagttcct
tattataacgaagtcatattaaaagatatgatggcaggaaagagagtgttaatagcagca
catggtaattcactacgtgcactgatgaaatatttggaagatatgtctccagaagatata
ttaaatgttaatcttcctactgggatacctttggtttatgaacttgatgaagaaggaaaa
tttattagtaaagagtatcttggagatgcagagtatgtaaaagctaagatagaaaaagta
tctgctcaaggaaaggttacaattgaataa

DBGET integrated database retrieval system