KEGG   Lachnoclostridium phytofermentans: Cphy_2785Help
Entry
Cphy_2785         CDS       T00619                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
cpy00340  Histidine metabolism
cpy01100  Metabolic pathways
cpy01110  Biosynthesis of secondary metabolites
cpy01230  Biosynthesis of amino acids
Module
cpy_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Cphy_2785
Enzymes [BR:cpy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Cphy_2785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh M-inducer_phosp
Motif
Other DBs
NCBI-ProteinID: ABX43145
UniProt: A9KNX5
Position
complement(3390821..3392134)
Genome map
AA seq 437 aa AA seqDB search
MIINMRIIELNESTKNNILENLLKRSPNQYREYEDQVAGIISDVKKRGDEALFEYSLRFD
KATITKETIRVTEEEIAKAYEQIPPSTLDVIRKSIHNIEAYHQKQKQYSWFDSEPNGVIL
GQKVTAIDAVGVYVPGGKAAYPSSVLMNVLPAKVAGVRRIAMTTPPGADGNVNPGTLVAA
KEAGVTEIYKVGGAQAIAALAYGTDSIKKVDKIVGPGNIYVALAKKAVYGNVSIDSIAGP
SEILVIADETANPRFVAADLLSQAEHDELASSILITTSESLAKKVSDEIDGFLEVLNRSE
IIRASLDNYGYILVAKNLSEAIDTANEIASEHLEIMTKNAFEVMTKIKNAGAIFIGEYSS
EPLGDYFAGPNHVLPTNGTAKFFSPLSVDDFIKKSSIISYSREALFPVYEDIVTFAKAEG
LTAHANSISVRFENDEV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgattattaatatgagaattatcgaattaaatgaatcaacaaaaaataatatattggaa
aacctactaaaacgtagtccgaatcaatatagagaatatgaagatcaagttgctggcatt
attagtgatgtaaaaaaacgtggcgatgaggctttatttgaatatagtttacgatttgat
aaagctaccatcacaaaggaaacgatacgtgtaacggaagaagaaattgcgaaggcatat
gaacagataccaccatcaacgcttgatgttatccgtaagtccatacataacattgaagct
tatcaccaaaaacaaaagcaatatagctggtttgacagtgagcccaatggtgttattctt
ggacaaaaggtaaccgcaatcgatgcagtaggtgtttatgtaccaggaggaaaggctgca
tatccatcttccgtattaatgaatgttttacctgcgaaagttgctggtgtcagacgaata
gctatgacaacaccaccaggtgctgatggcaatgtaaatccaggtaccttagttgcagcg
aaagaggcaggggtaaccgaaatctataaagtgggtggggcacaagcaatcgctgcactt
gcttatggaacggattcaataaaaaaagtagataagatagttggacctggtaacatctat
gtagcgcttgcaaaaaaagctgtatatggaaatgttagcattgattctatcgctggacca
agcgaaattcttgtaattgctgatgaaactgctaatccaagatttgttgcggcagacctt
ttatcacaagctgagcatgatgagttggcttcttctattctaattacaacaagtgaatca
cttgctaagaaagtatcagatgagatagatggattcttagaagttttaaatcgtagtgaa
atcattcgtgcttctttagataactatggatatattttggttgcgaaaaacttaagtgaa
gctattgatacagcaaatgagatagcttctgagcatcttgagattatgaccaagaatgcg
tttgaggtaatgacaaagattaagaatgctggtgccatctttattggagaatattcttct
gagccacttggagattattttgcaggacctaaccatgtactaccaacgaatgggaccgca
aaattcttctcaccactgagtgtagatgattttattaaaaagtccagtatcatttcttac
tcaagagaagccctttttcctgtttacgaggatattgtcacgtttgcaaaggcagaagga
cttacagctcatgctaattcaatatcagtgagatttgaaaacgacgaagtgtga

DBGET integrated database retrieval system