KEGG   Lachnoclostridium phytofermentans: Cphy_2848Help
Entry
Cphy_2848         CDS       T00619                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Cphy_2848
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cphy_2848
   00600 Sphingolipid metabolism
    Cphy_2848
Enzymes [BR:cpy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Cphy_2848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3490641..3492104)
Genome map
AA seq 487 aa AA seqDB search
MTSRRRLLSWNYKVFTEKGASQMKYQSNMVSDLQIAYIGGGSRGWAWTFMTDLAREPKLS
GTVRLFDIDKSAAEQNMFIGNSITQREDAIGKWNYETKETLEEALTGADFIVISILPGTF
DEMESDVHTPERLGIYQSVGDTAGPGGIIRALRTIPMFVDIAEAVKKYAPKAWVINYTNP
MTLCVKTLYHVFPEIKAFGCCHEVFGTQKVLKGIAEQVLGIEDIPRNEVHVNVLGINHFT
WFDYASYQGIDLFPIYRDYVKEHFEEGFIENDANWANTTFACSHRVKFDLFQKYGLIAAA
GDRHLAEFVPGDWYLKDPENVKSWKFGLTTVDWRKEDLKQRLEKSHRLVSGEEKVDLKAS
GEEGILLIKALCGLERVVSNVNIPNTNRQIPNIPDSVVVETNAIFERDAIRPIIAGEMPD
SILHLTIPHIQNHELVLKAALTCDKELVKQAFANDPLVKGRATAEEIDLLVEDMIQGSIK
YLPEGWK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtaggaggagacttcttagttggaactataaagtatttacagagaagggagct
agtcagatgaagtatcagagtaatatggtatcagatttacaaatagcttatattggtgga
ggttcccgaggatgggcatggactttcatgactgacctagcaagagagccaaaattatct
ggtactgttaggctgtttgatattgataaatccgcagcagaacaaaatatgtttattgga
aattcaatcacacaaagagaagatgccattggaaaatggaactatgaaacaaaagaaaca
ttagaggaggctctaaccggtgcagattttattgtgatatcgatattgcctgggactttt
gatgaaatggaatctgatgtacataccccagaacgtttgggaatttatcaatctgttgga
gatactgcaggtcctggtggcataatacgtgcacttcgcaccattcctatgtttgttgat
atagcagaagcagtaaaaaaatatgctcctaaagcatgggtaattaattatacgaatcca
atgactttatgtgtgaaaacattatatcatgtatttccagagattaaagcatttggttgt
tgtcatgaagtatttggaactcagaaagttttaaaagggatcgcagaacaggtgcttggt
attgaggatataccaagaaatgaagttcatgttaatgtcttagggattaatcactttact
tggtttgattatgcatcctatcaaggaatagatttattccctatctatagagattatgta
aaggaacattttgaggaaggttttatagaaaatgatgcaaactgggcaaatactacattt
gcatgttctcatcgtgtaaaatttgatttattccagaaatatggattgattgcagctgca
ggagatcgtcacttggcagagtttgtacctggcgattggtacttgaaagatccggaaaac
gtaaagagctggaagtttggattaactacagtagattggagaaaggaagaccttaaacag
agacttgagaaaagccatcgtttagtgagtggagaagagaaagttgatttaaaggcatct
ggagaagaaggaattttattaataaaagcgctctgtggtttagaaagagttgtaagtaat
gtaaatattccaaataccaacaggcaaataccgaatataccagattcagtggtggttgag
acaaatgctatttttgagagggatgccatacgtccaattattgcaggggagatgccagac
tctatcttacatttaaccataccacatatacaaaaccatgaactagtattaaaggctgca
cttacatgtgataaagagttagtaaagcaggcattcgccaatgatccattagtgaaagga
agagctactgcggaggaaattgatttactggtagaggacatgattcagggatctataaaa
tacttgccggaaggctggaaataa

DBGET integrated database retrieval system