KEGG   Clostridium phytofermentans: Cphy_2936Help
Entry
Cphy_2936         CDS       T00619                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cpy  Clostridium phytofermentans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cpy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3607450..3609303
Genome map
AA seq 617 aa AA seqDB search
MCGIAGFYHPRQNYLEKESYYKTILNCMTKRLYHRGPDEQGIYLNEHIGLAHARLSIIDL
VSGGQPMLRSFGERTYVIVYNGEIYNAEELKKELQQQGMSFQTTCDTEVILLGFIANGPD
FVKKLNGIFAYAIIDVAKNSLYLFRDQAGVKPLFYTLYEDTLIFSSEIKGLFEYPGFTPK
VTSEGLNEIFSIGPAKTPGCGVFDKVKEVLPGEMVCYNQSGFTKELYWKLVSKPHEDSYE
ETMERTGFLVTDAIRRQMVSDVPICTFLSGGIDSSIVTAVCANELKKKNKQLDTFSFDFV
NNEEFFKANKFQPSRDLPYALKMAEHFNTNHHLLECDNVMLAKRLHDSVLARDLPAMADI
DSSILHFCSLVKQYDKVALTGECADEIFGGYPWFHSEEAKKSHSFPWSRDLSARKQLLKD
EFLQCLHMDEYVQNAYETTVSETPYLAEDSEDERRLREISYLNLKWFMQTLLDRMDRTSM
YSGLEARVPFADIRIIEYLWNVPFSMKAPDGIVKGLLRMSCSGLLPDDILWRKKSPYPKT
YDPGYESLVATQLLEVMNDSSSPIVSFIDKKKLDSFLHTPSDYGKPWYGQLMAGPQTLAY
LLMINDWLETYHIETVI
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgctggtttctatcatcctagacaaaactacttagagaaagaatcctac
tataaaacaattttaaattgcatgaccaaacgtctttatcatcgcggtccggacgaacag
ggaatctatctgaatgaacacataggcttggctcatgcgcgtctatccatcattgacttg
gtttcaggcggacagccaatgctacgctcttttggagaaaggacgtacgtcatcgtatac
aatggcgaaatatataatgcagaggaattaaaaaaagagttgcaacaacaaggcatgagt
tttcaaacgacttgtgatactgaagtcatactacttggttttattgctaatggacctgat
ttcgtaaaaaaactgaatggtatctttgcttatgcaatcattgatgttgcaaagaattcc
ctctatctcttccgcgatcaagctggggtaaaacctttattctatactttatatgaggat
accttaatcttttcctctgagataaaaggattgtttgagtacccaggatttacaccgaaa
gttacgagcgaagggttaaatgaaatattctcaatcggtcctgccaaaacccctggatgc
ggtgtttttgataaggtcaaggaagttttaccaggggaaatggtttgctataaccaaagt
ggttttacgaaagaactctattggaaactggtgagcaagccacacgaggattcttatgaa
gaaaccatggaacgaactgggttcctagttacggatgcgatacgccgccagatggtcagt
gatgttccaatctgtacctttctctcaggtgggatagactctagtattgtaactgcagtt
tgtgcaaatgaattaaagaaaaagaataagcaacttgacaccttttcctttgacttcgtg
aacaatgaagaattttttaaagctaataaatttcagccatcaagagatctgccttatgca
ctgaaaatggcggagcattttaacaccaatcatcatcttctagaatgtgataatgttatg
ttagcgaagcgactacatgattccgtacttgcaagagatttgccagctatggcggatatc
gattcctctatcctacatttttgttctctcgtcaaacaatatgataaagtagctctgaca
ggggaatgcgcagatgaaatctttggaggctatccttggtttcatagtgaggaggccaaa
aaatctcattcctttccttggtcaagagacctaagtgcaagaaagcagttattaaaggat
gaatttcttcagtgtcttcatatggacgaatatgttcagaatgcgtatgaaacaacagtg
agtgaaacaccttatctcgcagaagattccgaggacgaaagaagacttagagaaatctct
tatctgaatcttaagtggtttatgcaaaccttattagatcgtatggatcgaaccagtatg
tatagtggattggaagctagagtaccttttgcagacataagaatcattgagtatctatgg
aatgttccattttctatgaaagctccggatggcatcgtaaaagggttattaagaatgagt
tgtagcggtttgttacccgatgatattctctggcgaaagaaatctccttatccaaaaacc
tatgatccaggatatgaatccttagttgctacacaattattagaagtaatgaatgatagt
tcttcaccaatcgtttcatttattgataagaaaaaactggattccttccttcatactcca
tctgattatgggaaaccatggtatggccaacttatggctggtccgcaaacactagcatac
ctcttaatgataaatgattggttagaaacttatcatattgaaacagtaatataa

DBGET integrated database retrieval system