KEGG   Clostridium phytofermentans: Cphy_3010Help
Entry
Cphy_3010         CDS       T00619                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cpy  Clostridium phytofermentans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3674634..3675599)
Genome map
AA seq 321 aa AA seqDB search
METLKEKYKDYFLIGAAVNASTIRTHGELIKDHFNSITCENEMKFSNLCPREKEYQFEKA
DTIVQFAKDNELKMRMHTLVWHNQTPEWVFLDTTKEGLEERLSNHIHMLGKRYGKDCYSV
DVVNEAIEDKLDGFLRESSWLQGLGNDYIERAFLLAKQEMPEAKLFYNDYNETNPIKRDK
IFKLIKELKEKGIPVDGIGMQCHINIYHSSMDELKEAIEKYLSLGVSIEITEMDVSMFRH
EDRSEILKPTIEQYKAQARVYKECFQIFREYKNDITSVTLWGVSDDVSWLNHFPVNNRRN
WPLLFDEMMKPKEAFYEIMNF
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccttaaaggaaaaatataaagattatttccttattggggcagcagtgaacgct
tcaacgataaggacacatggagagttaataaaggatcattttaactctataacatgtgaa
aatgagatgaagttttctaatctttgtcccagagagaaggaatatcagttcgaaaaagca
gatacgattgtgcagtttgcaaaagataatgaactgaaaatgagaatgcataccttagtt
tggcacaaccaaacgcctgaatgggtatttttagatactacgaaggaggggttagaggaa
aggctatcaaatcatatccatatgctaggtaagcggtatggaaaggattgttatagtgta
gatgtagtaaacgaagcgatagaggataaattagatggatttttaagagaatccagttgg
cttcagggattagggaatgattatatagaaagggcatttctccttgcgaagcaagagatg
ccagaggctaaactgttttataacgattataatgaaaccaatccaatcaagcgggataaa
atctttaaactaatcaaagaacttaaagagaaagggattccagtagacggtattgggatg
caatgccatatcaatatctatcattcttccatggatgaattaaaggaagcaattgaaaaa
tatttatcgcttggagtatcgattgagatcacggaaatggatgtatcaatgtttcgccat
gaagacaggtcagaaatcttgaaaccaacgatagaacagtataaagcacaggccagagtt
tacaaagagtgctttcagatatttagagaatataaaaatgatattacatccgtgacccta
tggggagtatcagatgatgtcagctggctaaaccattttccagtaaataaccgtagaaac
tggccattactgtttgatgagatgatgaaaccaaaagaagcattttatgaaattatgaat
ttttag

DBGET integrated database retrieval system