KEGG   Lachnoclostridium phytofermentans: Cphy_3053Help
Entry
Cphy_3053         CDS       T00619                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cphy_3053
Enzymes [BR:cpy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Cphy_3053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3733948..3734802)
Genome map
AA seq 284 aa AA seqDB search
MNKNIHTFLGCDANYEESEMVLFGAPYDGTTSYRPGTRFASAAIRNESYGIETFSPYQEK
DLTDYQIFDGGDLELPFGDPVRPLSLIEEFTANVLKDGKFPLMIGGEHLVTLGAMRTVVK
QYPDVHIIHFDAHADLREDYLGVKLSHATVMRRCHELVGDNKIYQFGIRSGDREEFLFGN
EHVTTCRFDFHTLDAVVEELERKQVPVYLTVDLDVLDPSVFPGTGTPEAGGATFTQLFDA
LQKVTRLKVVAADMNELSPIYDQSGASTALACKLLREMMLMLMK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaacatacatacctttttaggttgtgatgctaactatgaagaaagcgagatg
gtattgtttggagctccgtatgatggtaccacctcttatcgtcccggtacaagatttgca
agtgctgcaattcgaaatgagagttatggaatagaaacctttagcccatatcaagagaaa
gatttgacggattatcagatctttgatgggggagatttagaacttccttttggtgatcca
gtcagaccactttctttgatagaggagtttactgctaatgttttaaaggacggaaagttt
ccacttatgattggaggagagcacttagtaactttaggggcgatgcggacagttgtaaaa
cagtatccagatgtgcatatcatacattttgatgctcatgcagatttaagagaggattat
cttggagtaaaactgtctcatgcaacggttatgagaagatgtcatgagttagtgggggat
aacaaaatctatcagtttggaatccgaagtggagatagggaagagtttttattcggaaat
gaacacgttactacctgtagatttgattttcacaccttggatgctgtggttgaggaattg
gaaagaaagcaagttccggtctatcttacggtagatttggatgtacttgatccatcggta
tttccaggaacgggtacaccagaagctggcggtgctacttttactcaattatttgatgcc
ttgcaaaaggttacaagattgaaggtggtagcagcagatatgaatgagctttcaccaata
tatgaccaaagtggagcttccacagctttggcgtgtaagctacttcgagagatgatgcta
atgttgatgaaataa

DBGET integrated database retrieval system