KEGG   Clostridium phytofermentans: Cphy_3160Help
Entry
Cphy_3160         CDS       T00619                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cpy  Clostridium phytofermentans
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cpy00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cpy00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cpy00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3858979..3862536
Genome map
AA seq 1185 aa AA seqDB search
MSSQVHNNRRLMNDGWSFSKHQLGATLQQVLDAKTEWHPVDLPHDWLIYNTHDLYETGEG
WYRRTLSMEHLKNKERYILRFEGVYMNSTLYVNGRFAGEWKYGYSTFEFDITEFLTEGGN
EIVMQVIYESPNSRWYSGAGIYRNVWFHTYPEVHINPDGIYISTEKVDEDFYVFLSTEVS
SLPISMEPELTIPEDFHGLDKDSTSTLELRHTVWSPSHELVCTHTVDVTSEVVKNAFYVQ
DSKLHIISPLLWELSSPNLYQVQTDIIKDNIIIQSVTQNIGFRTIEYTCEEGFFLNGKHV
KLYGVCQHHDLGSLGAAINRTALRRQLTILKEMGVNAIRTSHNMPAVELMELADEMGFLI
NSEAFDIWERSKTTYDYARFFPKWADKDVASWIRRDRNHPSLIMWSIGNEIYDTHADERG
QEVTRMLLSFVRKHDSRINAPVTIGSNYMAWENAQKCADIVKLAGYNYAERLYGEHHELH
PDWMIYGSETASTLQSRGIYHFPYSKAILADDDEQCSSLGNTTSSWGARSTEYCITKDRD
ATFSAGQFIWTGWDYIGEPTPYFTKNSYFGQVDTAGFKKDTFYIYQAEWTDYKKSPMVHL
FPYWDFSKDQVIDLRVCSNAPRVELFFNENSLGTYDIDHKHGTQLCGHWQLPYEEGTLKA
VAYDEYGNIIATDTRTSFGDAANIKLSPDKTTMLVNCQDLIFVEISMEDCNGNPVENANN
RVTVEVTGAGRLIGLDNGDSTDYDQYKGISRRLFSGKLLAVIASTLTPGEITMKVTSETL
PAKTLSFTSIPCEYPEGLSDNMRNTDHIIYPVLNPKVIIPTTDEAEIPIRKLEIVTPNGT
TLSKDLSTIEAYVITHPANATYQDIDWRITNGSGIDSNLARLEKDGTKVKVIALGSGKAY
LRCTCRNGADKVRMISEIELNFHDLGEATMNPYEFIYGGLYSWSNTNLTNGIERGISSLL
PMDTYICFKNVDFGSYGSDEITVPIYCLDTELPTFEIWEGIPHEEGSELLADCSFSKKPI
WNHHQPETYRLKRRVKGIVTISFVVFKRLSVQGFQFTNPQKGFAKLFATDCDLIYGDTFT
KKAPRIEGIGNNVSLEFSEMDFGEQGITKLSICGHSPIEKNTIHVKFISEEGSMLYNSIE
ELAEFTFTNEYEVKEFEFSKKTGKYTVTFIFLPGSNFDFEWFKFE
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtcaagtacataacaatcgaagattaatgaatgatggctggagtttttccaaa
catcagctaggcgctaccttacaacaagtgttagatgcaaaaacagaatggcatcccgtt
gatttgccccacgactggttaatttataatacccacgatttgtatgaaacaggagaaggt
tggtacagacgtacgttatccatggaacacctgaaaaataaggagcgatatatattacgt
ttcgagggcgtgtatatgaactcgaccctctatgtcaatggaaggtttgctggagagtgg
aaatacggttactcaacatttgaattcgatataaccgagtttttaacagaaggtggcaat
gaaattgtgatgcaagttatctacgagtcaccgaactcgagatggtattccggtgcaggt
atttatcgtaatgtctggttccatacctatcctgaagtacatattaacccagatggaatt
tatatttcaacagaaaaagtggatgaggatttttacgttttcctatcaaccgaagtttcc
tctttaccgatcagtatggaacctgagcttacaataccagaggattttcatggattagac
aaggattccacatctacactcgaacttcgccatactgtatggtcgccaagtcatgaatta
gtttgcacccatactgtcgatgttacaagtgaggtagtaaagaatgccttttatgtacaa
gatagtaaactacatattatttcacctcttctttgggagctttcgtcaccaaatttatat
caagtgcaaactgatattatcaaagataatattataatacagtccgtaacacaaaacatt
ggttttcgcaccatagaatacacctgcgaagaaggctttttccttaatggtaaacatgta
aagctatatggagtatgtcaacaccacgaccttggtagccttggtgctgctattaatcgt
actgcccttcgtagacaactaacgattttaaaagaaatgggtgtgaatgctattcgtact
tcacacaatatgccagcagtagagttaatggaacttgcagatgagatgggatttttgatt
aattcggaagcctttgatatctgggagcgttcaaaaacaacctatgattatgctcgtttc
ttcccaaaatgggcagataaagatgtcgctagctggattcgtagagaccgcaaccaccct
tctctcatcatgtggagtattggaaatgaaatctatgatacacatgcagacgagcgtggt
caggaagttactagaatgttattaagctttgttcgaaaacatgattctcgcatcaatgct
cctgtaaccatcggctccaattacatggcatgggaaaatgctcagaagtgtgctgatatc
gtaaaactagctggatataactatgcagaacgactctacggggagcatcatgaattacat
ccagattggatgatatacggaagtgaaacggcatctaccttacaaagccgtggaatctat
catttcccatattcaaaggcaatccttgcagacgatgatgagcaatgctcttcccttggt
aatacgacttcaagctggggagcacgaagcacagaatactgtattacgaaagaccgtgat
gccacatttagtgccggacaattcatctggactggttgggactacatcggagagccaact
ccatattttacgaaaaactcttatttcggtcaggtagataccgctggttttaagaaagat
acattctatatctatcaggcagagtggacggattataaaaaatcaccaatggtacattta
ttcccatactgggatttctccaaagatcaggtgattgacttaagggtatgctccaatgcc
ccaagagtggaattgttttttaatgaaaactccctaggaacctatgatattgaccacaaa
catggtacacagctatgtggccattggcagttaccatatgaagaaggtaccttaaaagcg
gttgcatatgatgaatacggaaatattatagcaacagatacccgtacctcctttggtgat
gccgctaatattaaattatcaccggataaaaccaccatgcttgtgaattgccaagacctt
atttttgttgaaattagcatggaagattgtaatggcaatccagtagaaaatgcaaataat
cgtgttaccgtagaagttacgggtgctggtcgtctaattggactagataatggtgatagt
accgattatgatcaatataagggaatcagccgaagattgttcagtggaaaattacttgca
gttatagcatcaaccttaacaccaggtgaaattacaatgaaggttacctcagaaacttta
ccagcaaagactctctcctttacttccattccatgtgagtatccagaaggtcttagcgat
aatatgaggaatacggatcacatcatttatccagtactgaatccgaaagttataattcct
actacggatgaagccgagattccgattcgtaaactcgaaatagttacaccgaatgggact
actctttctaaagatttaagtacaattgaggcatatgtaatcactcatccagcaaatgct
acctatcaagatatcgattggagaataaccaatggatcgggtatagattccaatctagcc
agattagagaaggatggtaccaaggtaaaggtaattgcccttggtagcggtaaagcttat
cttcgttgtacctgtaggaatggtgcagataaggtacgtatgatttctgaaatagagctt
aacttccatgaccttggagaagctaccatgaatccgtatgaatttatatatggtggttta
tactcttggtccaatacaaaccttaccaacggaattgagcgcggtatctcctctctgcta
ccaatggatacttacatttgttttaaaaatgtagactttggctcctatggatctgacgag
attactgttccaatctactgtcttgatactgagcttccaacttttgagatttgggaaggt
atcccacatgaagaaggaagtgaattactagcagactgttcatttagtaaaaagccaata
tggaatcaccatcaaccggaaacctatcgattaaagcgtagagtaaaaggtatcgtaaca
atttccttcgttgtatttaaacgattaagcgttcaaggatttcagtttaccaatccacaa
aaaggatttgcaaaattattcgctactgattgtgacctcatatatggagatacctttaca
aagaaagctcctcgcattgaaggaatcgggaataacgtatccttggaattttcagagatg
gatttcggagaacagggcattacgaaactctctatctgtggtcattctccgattgagaag
aacaccattcatgtaaagtttatttcagaagaaggtagtatgctctataatagcattgaa
gaacttgcagaatttacttttacgaatgagtacgaagtaaaagagtttgaattctctaag
aagacaggtaaatatactgttacctttatattcctaccgggcagtaattttgactttgag
tggtttaagtttgaataa

DBGET integrated database retrieval system