KEGG   Lachnoclostridium phytofermentans: Cphy_3172Help
Entry
Cphy_3172         CDS       T00619                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cphy_3172
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cphy_3172
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cphy_3172
Enzymes [BR:cpy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cphy_3172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3873050..3874426)
Genome map
AA seq 458 aa AA seqDB search
MMKQEIPYKIYLEESEMPTKWYNVRADMKNKPAPLLNPQTLKPMTFDELKQVFCDELVKQ
ELDDTNAYIDIPEEILNFYKMYRPAPLVRAYCLEEKLQTPAKIYYKFEGNNTSGSHKLNS
AIAQAYYAKKQGLHGVTTETGAGQWGTALSMACSYFGLDCKVFMVKVSYEQKPFRREVMR
TYGAQVTPSPSLSTEVGKRILEAHPGTTGSLGCAISEAVETAVSTPGYRYVLGSVLSQVL
LHQSIIGLETKSALDKYGITPDIIIGCAGGGSNLGGLISPFMGEVLRGEKKYQFIAVEPA
SCPSLTRGKFAYDFCDTGMVCPLAKMYTLGSNFIPSANHAGGLRYHGMSSVLSQLYEDGL
MEARAVEQTAVFEAAEQFARIEGILPAPESSHAIRVAIDEALKCKETGEEKTIVFGLTGT
GYFDMVAYERFHNGEMTDYIPTDADLQEGFDGIPKQPE
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcaagaaataccttacaaaatctatcttgaagaaagcgagatgccaacaaaa
tggtataacgtgcgtgcagatatgaagaacaaaccagcaccattgttaaatccacaaaca
ttaaagccgatgacatttgatgaattaaagcaagtattttgcgatgaacttgtaaaacag
gagctggatgataccaatgcttatattgatatcccagaagaaatactaaacttttataag
atgtatcgcccagcaccgctagtacgagcatattgtttagaagaaaagttacaaactccc
gctaagatttattataaattcgaaggaaataataccagtggcagccacaaattaaactct
gcaattgcgcaagcatattatgcaaaaaagcaaggtctacatggtgttacaacagaaacc
ggtgctggtcagtgggggacggccctttcaatggcgtgttcctattttggcttagactgt
aaagtatttatggttaaggtatcttatgagcagaaacctttccgtagagaagttatgaga
acttatggagctcaggttaccccgtctccatcgttgtctactgaagtaggaaaaagaata
ttagaagcacatcctggaaccacaggaagtttaggttgtgcaatctccgaagcggtcgaa
accgcagtatcaacaccaggttatcgttatgtacttggcagtgttttgtctcaagtttta
ttacaccagtcaatcattggcttagaaacgaagtcagctcttgataaatatggtatcacc
ccagatattattattggttgtgctggtggtggttcgaatttaggcggtcttatctcacct
tttatgggcgaagtattgcgtggtgagaagaagtatcagtttattgcggtcgagccagca
tcctgcccaagtttaactagaggaaaatttgcctatgatttttgtgatactggtatggtt
tgccctcttgctaagatgtacacgttaggaagcaactttattccatctgctaatcacgca
ggaggacttcgctatcatggtatgagttccgtattatcccagctttacgaagatggtctt
atggaagcacgtgcagtagagcagaccgcagtatttgaggcagcggaacaatttgctagg
attgaaggaatcttacctgcgccagagagtagtcatgcaattcgtgtagcaatcgatgag
gcattaaagtgtaaggaaacaggggaagaaaagacgattgtatttggattaactggtact
ggatattttgatatggttgcttatgagcgttttcataacggagaaatgacggattatatt
ccaaccgacgctgatttacaggaaggatttgatggaataccaaaacagccggaataa

DBGET integrated database retrieval system