KEGG   Lachnoclostridium phytofermentans: Cphy_3202Help
Entry
Cphy_3202         CDS       T00619                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cphy_3202
Enzymes [BR:cpy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Cphy_3202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3898410..3900641)
Genome map
AA seq 743 aa AA seqDB search
MKRKLKQRCAVLVAVATMIASLQWGRVPVQAVTADGLTSQQYVEAMGEGWNLGNSFDGFD
SDTSKPDQGETAWGNPKVTKELIHAVKQKGYSSIRIPMTLYRRYTESNGVCTIDSAWIAR
YKEVVDYAVAEGLYVMINIHHDSWIWLSSWDGNKSSVQYVRFTQMWDQLAKAFKDYPLQV
CFETINEPNFQNSGNVTAQNKLDMLNQAAYNIIRASGGSNAKRMIVLPSLNTNHDNSVPL
ADFITKLNDSNIIATVHYYSEWVFSANLGKTSFDEDLWGNGDYTPRDAVNKAFDTISNAF
TAKKIGVVIGEFGLLGYDSDFENNQPGEELKYYEYMNYVARQKKMCLMFWDNGSGINRND
SKYSWKKPIVGKMLEVSMTGRSSYATGLDTIYLNGSSFNDINIPLTLNGNTFVGVTGLTS
GTDFTYNQSNATLTLKSSYVKKVYDAMGSNYGTVADLVLKFSSGADWHEYLVKYKAPVFQ
NANGTVSNGINIPVQFNGSKLRRSTAYIGSNRVGPNQSWWMYLEYGATFVANYTNNILTI
KPDFFKDGSVYDGNISFEMEFYDGQKLKYNLNKSNGNITGTAAAVTPTPTPTATPTPTAT
PTPTVTPKPTITPTVTPTPTVTPKPTITPTVTPTPTPIPGTGPVTLKYEVTNTWDKHTQA
NITLTNTSNTALKNFVVSFTYKGYIDQMWSADLVSQNSGTITVKGPAWATNLDPGQSITF
GFIASHDTPSVDPPSNVTLVSSN
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaaactgaaacaaagatgtgctgttttagtggcagttgcaacgatgatagct
tcgttgcaatgggggagagtgccagtacaagcagtaacagcagacggtcttacctctcaa
cagtatgttgaggcaatgggcgaaggctggaacttaggaaattcctttgatggttttgat
tctgatacttcaaaaccagatcaaggcgagaccgcttggggaaatcctaaggttacaaaa
gagctaatccatgcagtcaaacaaaaaggctatagtagtatccgcataccaatgacccta
tatcgtagatatacggagagcaatggtgtatgcactatcgatagcgcatggatagcacgt
tacaaagaagtagtagattatgcagttgcagaaggtttatacgttatgataaacattcac
catgattcctggatatggttatcttcatgggatggaaataagagttctgtgcaatatgta
agatttactcagatgtgggatcaacttgcgaaggcatttaaagattatccgttacaagta
tgttttgaaacgataaatgagccgaactttcaaaactctggaaacgttactgcacagaat
aaattagatatgcttaaccaagcggcttacaatataattcgtgcctctggtggatcaaat
gcaaagagaatgattgttttaccatcactaaatacgaaccatgataatagtgtaccatta
gctgatttcataactaaattgaatgattctaatatcattgcaaccgttcattattatagt
gaatgggtatttagtgctaaccttggtaagacaagctttgatgaagatttatggggaaat
ggtgattacactcctcgtgatgcggtaaataaggcgtttgataccatttccaatgcattt
acagcaaaaaaaatcggtgttgttatcggagaatttggtcttttaggttatgactctgat
tttgaaaataatcaaccaggcgaagaattaaaatattatgagtatatgaattatgtagct
agacaaaagaaaatgtgccttatgttttgggataacggatctggaattaatcgtaacgac
tctaagtatagttggaaaaaacctatagttggaaagatgttagaagtatctatgacagga
cgttcctcttatgcaacaggccttgataccatttacctaaacggcagctcatttaatgat
attaatatcccgcttactctaaacggtaacacctttgttggagttacaggattaaccagt
ggtaccgattttacgtataaccaatccaatgcaacactaacattaaaatcatcctacgtg
aagaaggtttatgatgcaatgggaagtaattatggtacggtagctgatttggtacttaag
ttttcaagtggagctgattggcatgagtatttagtgaaatacaaagcaccagtatttcaa
aatgcgaatggaactgtttccaatggaattaatattccagttcaatttaacggaagtaaa
ctccgtcgttctacagcttatataggttctaatcgagttggcccgaatcaaagctggtgg
atgtatttagagtatggtgcaacttttgtggcgaactatacgaacaatattttaaccatt
aagcctgatttctttaaggatggttctgtttatgatggaaatatatcatttgagatggag
ttttatgatggacaaaagttaaaatataatcttaataaatcaaatggtaacataacagga
actgcagcagcagtaacccctacaccaacaccaacggcgacaccaacaccaacagcgacg
ccaacaccaaccgtaacaccaaaaccaacaataaccccaacagtaacgccgacaccaaca
gtaacgccaaaaccaacaataacaccgacagtaacaccaactcctactccaatcccagga
acaggtccagttacattaaaatacgaagtaacgaatacttgggataagcatacacaggcg
aatattacattaaccaatacctctaatacagcactaaagaattttgttgtatcatttact
tataaagggtatatagaccaaatgtggagtgcagatttggttagtcaaaattcgggtacc
attacagtgaagggaccagcatgggctacgaatctagatccagggcaaagtataacattt
ggttttattgcttcacatgatacaccgtctgttgatccaccatcaaatgttactttagtt
agttcaaattaa

DBGET integrated database retrieval system