KEGG   Clostridium phytofermentans: Cphy_3396Help
Entry
Cphy_3396         CDS       T00619                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
cpy  Clostridium phytofermentans
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cpy00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cpy00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cpy00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4154932..4156332)
Genome map
AA seq 466 aa AA seqDB search
MKYNNGKVSDVKIAYIGGGSRGWAWTFMTDLAMEPNMSGKISLYDIDQEAAKNNEIIGNM
ITRRDDTVGKWNYETANTMEAALTGADFVVISILPGTFDEMEADVHMPERLGIYQSVGDT
AGPGGMMRALRTIPMFVTIANAIKEYSPKAWVINYTNPMSMCVKTLYHVFPEIKAFGCCH
EVFGTQKVLKGIAEQELKIDRIDRNDIHVNVLGINHFTWFNYASYQGIDLFPIYCKYIED
HFEEGFEEKDENWANASFACKHRVKFDLFNEFGLIAAAGDRHLTEFMPSERYLKDKETVA
DWNFGLTTVEWRKKDLEDRLNKSHRLVSGEEEIKLEPSGEEGILLIKALCGLTRVISNVN
IPNTNLQIENLPSTAIVETNAVFERDSIRPIMAGEMPENVVKLTMPHILNHEYIMEAALT
FDKSLVVKAFEQDPLVKDMATKEEVEKLVEDMLDATKAYLPKEWNL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataataatggaaaagtttctgatgtaaaaattgcttatataggaggcggatct
cgtggctgggcatggacatttatgacagatttggctatggaaccaaatatgagcggtaag
atatctctatatgatattgatcaagaggctgcaaaaaataacgaaatcattggtaatatg
ataaccagacgagatgatacggttggaaaatggaactacgagacagctaatactatggaa
gcggcgttaacgggggccgactttgttgtaatttctatactacctggaacctttgatgag
atggaagcagatgtacatatgccggagcgtctaggaatctaccagtccgttggagatact
gctggaccaggaggtatgatgagggctcttcgtaccattccgatgtttgttacaatagct
aacgcaattaaagagtactcgcctaaagcttgggtcattaattataccaacccaatgtct
atgtgtgtaaaaacgttatatcatgtatttccggaaattaaagcatttggttgctgtcat
gaggtatttggaacacagaaggttctaaaaggaatcgctgaacaggaattaaagatagat
cgtattgatcgaaacgatatccatgtcaatgtacttggcattaatcattttacttggttt
aattatgcttcctatcaagggattgatttgttccctatttattgtaagtatattgaagat
cattttgaagaaggatttgaagaaaaagatgagaactgggcaaatgcatcctttgcttgt
aagcaccgtgtgaagtttgacttatttaacgaatttggtttaattgcagcggcaggtgat
cgacacctgacagagtttatgccaagcgaacgatatttaaaggataaagagacggtagca
gattggaactttggtctaacaacagttgaatggagaaaaaaagatttagaagaccgttta
aataagagccatcgattggttagcggagaagaagagattaaacttgagccatctggtgaa
gaaggcatactattaatcaaagcactttgtggtttaacaagagttattagtaatgtgaat
attcctaatacgaatcttcagattgaaaatcttccaagtactgcaattgtggaaacgaat
gcggtgtttgagagagattccatacgacctattatggcgggtgaaatgccagaaaacgtt
gttaaattaacaatgcctcatattttaaatcacgagtacattatggaagcagcgcttacc
ttcgataaatccttggtggtgaaagcatttgaacaggacccattagtaaaggatatggca
acaaaagaagaagtagaaaaacttgtagaggatatgttagatgctacaaaggcatatctt
ccaaaagagtggaatctatag

DBGET integrated database retrieval system